public Digest ( IEnumerable |
||
proteases | IEnumerable |
The proteases to digest with |
maxMissedCleavages | int | The max number of missed cleavages generated, 0 means no missed cleavages |
minLength | int | The minimum length (in amino acids) of the peptide |
maxLength | int | The maximum length (in amino acids) of the peptide |
initiatorMethonine | bool | |
includeModifications | bool | |
semiDigestion | bool | |
리턴 | IEnumerable |
public void DuplicatePeptidesAreEqualivant() { Protein prot = new Protein("DEREKDEREK"); var peptides = prot.Digest(Protease.GetProtease("LysC"), 0).ToList(); Assert.AreEqual(peptides[0], peptides[1]); }
public void DuplicatePeptidesReturn() { Protein prot = new Protein("DEREKDEREK"); var peptides = prot.Digest(Protease.GetProtease("LysC"), 0).ToList(); Assert.AreEqual(peptides.Count, 2); }
public void SemiTrypiticDigestion() { Protein prot = new Protein("MMRGFKQRLIKKTTGSSSSSSSKKKDKEKEKEKSSTTSSTSKKPASASSSSHGTTHSSASSTGSKSTTEKGKQSGSVPSQ"); var peptides = prot.Digest(Protease.GetProtease("Trypsin"), 0, 5, 10, semiDigestion: true).ToList(); Assert.AreEqual(17, peptides.Count); }