private IsotopicProfile GetTheorIsotopicProfile(IsosResult saturatedFeature, double lowerIntensityCutoff = 0.0001)
        {
            var theorTarget = new PeptideTarget
            {
                ChargeState      = (short)saturatedFeature.IsotopicProfile.ChargeState,
                MonoIsotopicMass = saturatedFeature.IsotopicProfile.MonoIsotopicMass
            };

            theorTarget.MZ = (theorTarget.MonoIsotopicMass / theorTarget.ChargeState) + Globals.PROTON_MASS;

            var averagineFormula =
                _tomIsotopicPatternGenerator.GetClosestAvnFormula(saturatedFeature.IsotopicProfile.MonoIsotopicMass, false);

            theorTarget.IsotopicProfile = _tomIsotopicPatternGenerator.GetIsotopePattern(averagineFormula,
                                                                                         _tomIsotopicPatternGenerator.aafIsos);
            theorTarget.EmpiricalFormula = averagineFormula;
            theorTarget.CalculateMassesForIsotopicProfile(saturatedFeature.IsotopicProfile.ChargeState);

            //NOTE: This is critical to choosing the optimum peak of the observed isotopic profile
            //A value of 0.001 will leave more peaks in the theor profile. This
            //can be bad with co-eluting peptides, so that a peak of the interfering peptide
            //is used to correct the intensity of our target peptide.
            //A value of 0.01 helps prevent this (by trimming the peaks of the theor profile,
            //and reducing the peaks to be considered for peak intensity extrapolation of the target peptide.
            PeakUtilities.TrimIsotopicProfile(theorTarget.IsotopicProfile, lowerIntensityCutoff);

            return(theorTarget.IsotopicProfile);
        }
        public static List <PeptideTarget> CreateN14N15TestMassTagList()
        {
            var mtList = new List <PeptideTarget>();

            var mt1 = new PeptideTarget();

            mt1.ID = 23085473;
            mt1.NormalizedElutionTime = 0.3807834F;
            mt1.MonoIsotopicMass      = 2538.33284203802;
            mt1.ChargeState           = 3;
            mt1.MZ               = mt1.MonoIsotopicMass / mt1.ChargeState + Globals.PROTON_MASS;
            mt1.Code             = "AIHQPAPTFAEQSTTSEILVTGIK";
            mt1.EmpiricalFormula = mt1.GetEmpiricalFormulaFromTargetCode();

            mtList.Add(mt1);


            var mt2 = new PeptideTarget();

            mt2.ID = 23085470;
            mt2.NormalizedElutionTime = 0.6053093f;
            mt2.MonoIsotopicMass      = 2329.24291507994;
            mt2.ChargeState           = 3;
            mt2.MZ               = mt2.MonoIsotopicMass / mt2.ChargeState + Globals.PROTON_MASS;
            mt2.Code             = "TAIRDPNPVIFLENEILYGR";
            mt1.EmpiricalFormula = mt1.GetEmpiricalFormulaFromTargetCode();

            mtList.Add(mt2);

            return(mtList);
        }
        public void PartialLabelingQuantifierTest1()
        {
            // see https://jira.pnnl.gov/jira/browse/OMCS-743


            var peptideSeq = "SAMPLERSAMPLER";
            var isoCreator = new LabeledIsotopicProfileUtilities();

            var elementLabelled = "C";
            var lightIsotope    = 12;
            var heavyIsotope    = 13;

            var target = new PeptideTarget();

            target.Code             = peptideSeq;
            target.EmpiricalFormula = target.GetEmpiricalFormulaFromTargetCode();
            target.ChargeState      = 2;
            target.CalculateMassesForIsotopicProfile(target.ChargeState);


            target.IsotopicProfile = isoCreator.CreateIsotopicProfileFromEmpiricalFormula(target.EmpiricalFormula, elementLabelled, 12, 13, 0, target.ChargeState);


            double[] obsMZVals =
            {
                794.4027177, 794.9043951, 795.4060725, 795.9077499, 796.4094273, 796.9111047,
                797.4127822, 797.9144596,  798.416137, 798.9178144, 799.4194918, 799.9211693,
                800.4228467, 800.9245241, 801.4262015, 801.9278789, 802.4295564, 802.9312338,
                803.4329112, 803.9345886,  804.436266, 804.9379435, 805.4396209, 805.9412983,
                806.4429757, 806.9446531, 807.4463306,  807.948008, 808.4496854, 808.9513628,
                809.4530402, 809.9547176, 810.4563951
            };

            double[] obsIntensities =
            {
                0.202610146, 0.169786958,  0.10004317, 0.048528412, 0.023649271,  0.01375091,
                0.011401505, 0.010165125,           0,           0,           0,           0,0, 0.016295369, 0.02039971, 0.02628524
                ,            0.034368448, 0.042300575, 0.050392505, 0.057402354, 0.061016738,
                0.061990991, 0.059175713, 0.053291295, 0.046892873, 0.037952256,            0.030884989
                ,            0.024965924, 0.019531111,  0.01613184,           0,           0, 0
            };



            var peakList = obsMZVals.Select((t, i) => new Peak(t, (float)obsIntensities[i], 0)).ToList();

            var partialLabelingQuantifier = new PartialLabelingQuantifier("C", 12, 13);

            var bestIso = partialLabelingQuantifier.FindBestLabeledProfile(target, peakList, null);

            var counter = 0;

            foreach (var currentFitScore in partialLabelingQuantifier.FitScoreData)
            {
                Console.WriteLine(currentFitScore.Key + "\t" + currentFitScore.Value);
                counter++;
            }
        }
Exemplo n.º 4
0
 private void addInfoToResult(IsotopicProfile iso, PeptideTarget mt)
 {
     if (iso != null)
     {
         iso.ChargeState           = mt.ChargeState;
         iso.MonoIsotopicMass      = (iso.GetMZ() - Globals.PROTON_MASS) * mt.ChargeState;
         iso.IntensityMostAbundant = iso.getMostIntensePeak().Height;     // may need to change this to sum the top n peaks.
     }
 }
        private PeptideTarget convertTextToMassTag(List <string> lineData)
        {
            var mt = new PeptideTarget();

            mt.ChargeState = (short)parseIntField(getValue(new string[] { "z", "charge_state", "charge" }, lineData, "0"));

            mt.ID   = parseIntField(getValue(new string[] { "id", "targetid", "target_id", "mass_tag_id", "massTagid" }, lineData, "-1"));
            mt.Code = getValue(new string[] { "peptide", "sequence" }, lineData, "");

            var scanNum = parseIntField(getValue(new string[] { "scannum", "scan", "scanNum" }, lineData, "-1"));

            mt.NormalizedElutionTime = parseFloatField(getValue(new string[] { "net", "avg_ganet", "ElutionTimeTheor" }, lineData, "-1"));

            var neitherScanOrNETIsProvided = mt.NormalizedElutionTime == -1 && scanNum == -1;

            if (neitherScanOrNETIsProvided)
            {
                mt.ElutionTimeUnit       = Globals.ElutionTimeUnit.NormalizedElutionTime;
                mt.NormalizedElutionTime = 0.5f;  // set the NET mid-way between 0 and 1.
            }

            var useScanNum = ((int)mt.NormalizedElutionTime == -1 && scanNum != -1);

            if (useScanNum)
            {
                mt.ScanLCTarget = scanNum;
                //mt.NormalizedElutionTime = scanNum / ;
                mt.ElutionTimeUnit = Globals.ElutionTimeUnit.ScanNum;
            }



            mt.ObsCount         = parseIntField(getValue(new string[] { "obs", "obscount" }, lineData, "-1"));
            mt.MonoIsotopicMass = parseDoubleField(getValue(new string[] { "mass", "monoisotopicmass", "monoisotopic_mass" }, lineData, "0"));
            mt.EmpiricalFormula = getValue(new string[] { "formula", "empirical_formula", "empiricalformula" }, lineData, "");
            mt.ModCount         = parseShortField(getValue(new string[] { "modCount", "mod_count" }, lineData, "0"));
            mt.ModDescription   = getValue(new string[] { "mod", "mod_description" }, lineData, "");
            if (mt.ChargeState == 0)
            {
            }
            else
            {
                mt.MZ = parseDoubleField(getValue(new string[] { "mz" }, lineData, "0"));
                if (mt.MZ == 0 || mt.MZ == double.NaN)
                {
                    mt.MZ = mt.MonoIsotopicMass / mt.ChargeState + Globals.PROTON_MASS;
                }
            }

            mt.GeneReference = getValue(new string[] { "reference" }, lineData, "");

            mt.RefID = parseIntField(getValue(new string[] { "ref_id" }, lineData, "-1"));
            mt.ProteinDescription = getValue(new string[] { "description", "protein" }, lineData, "");

            return(mt);
        }
Exemplo n.º 6
0
        public void initializeFromEmpiricalFormula()
        {
            var mt = new PeptideTarget();

            mt.Code             = "SAMPLER";
            mt.EmpiricalFormula = mt.GetEmpiricalFormulaFromTargetCode();

            Assert.AreEqual("C33H58N10O11S", mt.EmpiricalFormula);
            Assert.AreEqual(33, mt.GetAtomCountForElement("C"));
        }
Exemplo n.º 7
0
        public N14N15ResultObject(String datasetName, PeptideTarget mt)
        {
            this.DatasetName = datasetName;
            this.MassTag     = mt;

            this.ChromListLabeled           = new List <XYData>();
            this.ChromListUnlabeled         = new List <XYData>();
            this.ChromPeakSelectedLabeled   = new List <Peak>();
            this.ChromPeakSelectedUnlabeled = new List <Peak>();
        }
Exemplo n.º 8
0
        public void test3()
        {
            TargetBase target = new PeptideTarget();

            target.Code             = "TTPSIIAYTDDETIVGQPAKRTTPSIIAYTDDETIVGQPAKRTTPSIIAYTDDETIVGQPAKR";
            target.EmpiricalFormula = target.GetEmpiricalFormulaFromTargetCode();

            var cluster = _tomIsotopicPatternGenerator.GetIsotopePattern(target.EmpiricalFormula, _tomIsotopicPatternGenerator.aafIsos);


            TestUtilities.DisplayIsotopicProfileData(cluster);
        }
Exemplo n.º 9
0
        public PeptideTarget CreateMT23085904_Z2()
        {
            var mt = new PeptideTarget();

            mt.ChargeState      = 2;
            mt.Code             = "AMPIDLSNLALLDANGK";
            mt.EmpiricalFormula = mt.GetEmpiricalFormulaFromTargetCode();
            mt.MonoIsotopicMass = 1754.923582420;
            mt.MZ = 878.4690677;
            mt.NormalizedElutionTime = 0.4509717f;

            return(mt);
        }
Exemplo n.º 10
0
        public PeptideTarget CreateMT23140708_Z2()
        {
            var mt = new PeptideTarget();

            mt.ChargeState      = 2;
            mt.Code             = "IVKVNVDENPESPAMLGVR";
            mt.EmpiricalFormula = mt.GetEmpiricalFormulaFromTargetCode();
            mt.MonoIsotopicMass = 2066.08292;
            mt.MZ = 1034.048737;
            mt.NormalizedElutionTime = 0.329644f;

            return(mt);
        }
Exemplo n.º 11
0
        private IsotopicProfile getTheorProfile(PeptideTarget massTag, Globals.IsotopicProfileType isotopicProfileType)
        {
            switch (isotopicProfileType)
            {
            case Globals.IsotopicProfileType.UNLABELLED:
                return(massTag.IsotopicProfile);

            case Globals.IsotopicProfileType.LABELLED:
                return(massTag.IsotopicProfileLabelled);

            default:
                return(massTag.IsotopicProfile);
            }
        }
        protected TargetCollection GetMassTagTargets(string massTagFileName, List <int> targetIDsToFilterOn)
        {
            if (String.IsNullOrEmpty(massTagFileName) || !File.Exists(massTagFileName))
            {
                return(new TargetCollection());
            }


            if (massTagFileName.ToLower().Contains("_msgfplus.tsv"))
            {
                var iqTargetImporter = new BasicIqTargetImporter(massTagFileName);
                var iqTargets        = iqTargetImporter.Import();

                var targetUtilities  = new IqTargetUtilities();
                var targetCollection = new TargetCollection
                {
                    TargetList = new List <TargetBase>()
                };

                foreach (var iqTarget in iqTargets)
                {
                    if (iqTarget.QualityScore > MsgfFdrScoreCutoff)
                    {
                        continue;
                    }
                    targetUtilities.UpdateTargetMissingInfo(iqTarget);

                    TargetBase oldStyleTarget = new PeptideTarget();
                    oldStyleTarget.ChargeState      = (short)iqTarget.ChargeState;
                    oldStyleTarget.Code             = iqTarget.Code;
                    oldStyleTarget.EmpiricalFormula = iqTarget.EmpiricalFormula;
                    oldStyleTarget.ID = iqTarget.ID;
                    oldStyleTarget.MZ = iqTarget.MZTheor;
                    oldStyleTarget.MonoIsotopicMass      = iqTarget.MonoMassTheor;
                    oldStyleTarget.ScanLCTarget          = iqTarget.ScanLC;
                    oldStyleTarget.NormalizedElutionTime = (float)iqTarget.ElutionTimeTheor;

                    oldStyleTarget.ElutionTimeUnit = DeconTools.Backend.Globals.ElutionTimeUnit.ScanNum;
                    targetCollection.TargetList.Add(oldStyleTarget);
                }

                return(targetCollection);
            }


            var importer = new MassTagFromTextFileImporter(massTagFileName);

            return(importer.Import(targetIDsToFilterOn));
        }
Exemplo n.º 13
0
        public static List <PeptideTarget> CreateO16O18TestMassTagList1()
        {
            var mtList = new List <PeptideTarget>();

            var mt = new PeptideTarget();

            mt.ID = 1142;
            mt.MonoIsotopicMass = 921.4807035;
            mt.ChargeState      = 2;
            mt.MZ               = mt.MonoIsotopicMass / mt.ChargeState + Globals.PROTON_MASS;
            mt.Code             = "AEFVEVTK";
            mt.EmpiricalFormula = mt.GetEmpiricalFormulaFromTargetCode();
            mtList.Add(mt);
            return(mtList);
        }
Exemplo n.º 14
0
        public static List <PeptideTarget> CreateTestMassTagList()
        {
            var mtList = new List <PeptideTarget>();

            var mt = new PeptideTarget();

            mt.ID = 24769;
            mt.MonoIsotopicMass = 2086.0595;
            mt.ChargeState      = 2;
            mt.MZ               = mt.MonoIsotopicMass / mt.ChargeState + Globals.PROTON_MASS;
            mt.Code             = "DFNEALVHQVVVAYAANAR";
            mt.EmpiricalFormula = mt.GetEmpiricalFormulaFromTargetCode();
            mtList.Add(mt);
            return(mtList);
        }
Exemplo n.º 15
0
        public static PeptideTarget GetMassTagStandard(int standardNum)
        {
            var mt = new PeptideTarget();

            mt.ID = 86963986;
            mt.MonoIsotopicMass = 1516.791851;
            mt.Code             = "AAKEGISCEIIDLR";

            mt.EmpiricalFormula      = mt.GetEmpiricalFormulaFromTargetCode();
            mt.NormalizedElutionTime = 0.2284955f;
            mt.ChargeState           = 2;
            mt.MZ = mt.MonoIsotopicMass / mt.ChargeState + Globals.PROTON_MASS;

            return(mt);
        }
Exemplo n.º 16
0
        public static List <PeptideTarget> CreateN14N15TestMassTagList()
        {
            var mtList = new List <PeptideTarget>();

            var mt = new PeptideTarget();

            mt.ID = 23085473;
            mt.NormalizedElutionTime = 0.3807834F;
            mt.MonoIsotopicMass      = 2538.33284203802;
            mt.ChargeState           = 3;
            mt.MZ               = mt.MonoIsotopicMass / mt.ChargeState + Globals.PROTON_MASS;
            mt.Code             = "AIHQPAPTFAEQSTTSEILVTGIK";
            mt.EmpiricalFormula = mt.GetEmpiricalFormulaFromTargetCode();
            mtList.Add(mt);
            return(mtList);
        }
        public override void GetFitScores(IEnumerable <IsosResult> isosResults)
        {
            foreach (var result in isosResults)
            {
                //create a temporary mass tag, as a data object for storing relevant info, and using the CalculateMassesForIsotopicProfile() method.
                var mt = new PeptideTarget
                {
                    ChargeState      = (short)result.IsotopicProfile.ChargeState,
                    MonoIsotopicMass = result.IsotopicProfile.MonoIsotopicMass
                };

                mt.MZ = (mt.MonoIsotopicMass / mt.ChargeState) + Globals.PROTON_MASS;

                //TODO: use Josh's isotopicDistribution calculator after confirming averagine formula
                mt.EmpiricalFormula = _tomIsotopicPatternGenerator.GetClosestAvnFormula(result.IsotopicProfile.MonoIsotopicMass, false);

                mt.IsotopicProfile   = _tomIsotopicPatternGenerator.GetIsotopePattern(mt.EmpiricalFormula, _tomIsotopicPatternGenerator.aafIsos);
                TheorIsotopicProfile = mt.IsotopicProfile;

                mt.CalculateMassesForIsotopicProfile(mt.ChargeState);

                var theorXYData = mt.IsotopicProfile.GetTheoreticalIsotopicProfileXYData(result.IsotopicProfile.GetFWHM());

                offsetDistribution(theorXYData, mt.IsotopicProfile, result.IsotopicProfile);

                // Obsolete Class-wide variable: MercuryDistributionCreator distributionCreator;
                //
                //double resolution = result.IsotopicProfile.GetMZofMostAbundantPeak() / result.IsotopicProfile.GetFWHM();
                //distributionCreator.CreateDistribution(result.IsotopicProfile.MonoIsotopicMass, result.IsotopicProfile.ChargeState, resolution);
                //distributionCreator.OffsetDistribution(result.IsotopicProfile);
                //XYData theorXYData = distributionCreator.Data;

                var areaFitter = new AreaFitter();
                var fitVal     = areaFitter.GetFit(theorXYData, result.Run.XYData, 0.1, out _);

                if (double.IsNaN(fitVal) || fitVal > 1)
                {
                    result.IsotopicProfile.Score = 1;
                }
                else
                {
                    result.IsotopicProfile.Score = fitVal;
                }
            }
        }
Exemplo n.º 18
0
        public override TargetCollection Import()
        {
            var targetCollection = new TargetCollection();

            targetCollection.TargetList.Clear();

            GetMassTagDataFromDB(targetCollection, MassTagsToBeRetrieved);

            GetModDataFromDB(targetCollection, MassTagsToBeRetrieved);

            var peptideUtils = new PeptideUtils();

            var troubleSomePeptides = new List <TargetBase>();

            foreach (var targetBase in targetCollection.TargetList)
            {
                var peptide = (PeptideTarget)targetBase;
                var baseEmpiricalFormula = peptideUtils.GetEmpiricalFormulaForPeptideSequence(peptide.Code);

                if (peptide.ContainsMods)
                {
                    var peptide1 = peptide;
                    var mods     = (from n in _massTagModData where n.Item1 == peptide1.ID select n);

                    foreach (var tuple in mods)
                    {
                        var modString = tuple.Item4;

                        try
                        {
                            baseEmpiricalFormula = EmpiricalFormulaUtilities.AddFormula(baseEmpiricalFormula, modString);
                        }
                        catch
                        {
                            Console.WriteLine("Failed to calculate empirical formula for the Target " + peptide.ID +
                                              "; Having trouble with the mod: " + modString + "; This Target was NOT imported!!");

                            troubleSomePeptides.Add(peptide);
                        }
                    }
                }

                try
                {
                    peptide.EmpiricalFormula = baseEmpiricalFormula;
                }
                catch
                {
                    Console.WriteLine("Failed to calculate empirical formula for the Target " + peptide.ID +
                                      "; Cannot parse this formula: " + peptide.EmpiricalFormula + "; This Target was NOT imported!!");

                    troubleSomePeptides.Add(peptide);
                }
            }

            var cleanTargetList = new List <TargetBase>();

            //filter out the bad peptides (the once with errors during empirical formula parsing)
            foreach (var peptide in targetCollection.TargetList)
            {
                if (!troubleSomePeptides.Contains(peptide))
                {
                    cleanTargetList.Add(peptide);
                }
            }

            targetCollection.TargetList = cleanTargetList;

            if (ChargeStateRangeBasedOnDatabase)
            {
                targetCollection.ApplyChargeStateFilter(ChargeStateFilterThreshold);
            }
            else
            {
                var chargeStateTargets = new List <TargetBase>();

                foreach (var targetBase in targetCollection.TargetList)
                {
                    var minCharge = 1;
                    var maxCharge = 100;

                    for (var charge = minCharge; charge <= maxCharge; charge++)
                    {
                        var mz = targetBase.MonoIsotopicMass / charge + Globals.PROTON_MASS;

                        if (mz < MaxMZForChargeStateRange)
                        {
                            if (mz < MinMZForChargeStateRange)
                            {
                                break;
                            }

                            TargetBase chargeStateTarget = new PeptideTarget((PeptideTarget)targetBase);
                            chargeStateTarget.ChargeState = (short)charge;
                            chargeStateTarget.MZ          = chargeStateTarget.MonoIsotopicMass / charge + Globals.PROTON_MASS;
                            chargeStateTarget.ObsCount    = -1;
                            chargeStateTargets.Add(chargeStateTarget);
                        }
                    }
                }

                targetCollection.TargetList = chargeStateTargets.OrderBy(p => p.ID).ThenBy(p => p.ChargeState).ToList();
            }

            return(targetCollection);
        }
        public void CalculateLabelingDistributionTest2()
        {
            //mass_tag_id	monoisotopic_mass	NET	obs	mod_count	mod_description	pmt	peptide	peptideex
            //355176429	1538.8166126	0.42422	1	0		2.00000	LFLASACLYGAALAGV	R.LFLASACLYGAALAGV.C


            //------------------------load theor data ------------------------------------

            var peptideUtils = new PeptideUtils();

            var peptide = new PeptideTarget();

            peptide.Code             = "LFLASACLYGAALAGV";
            peptide.EmpiricalFormula = new PeptideUtils().GetEmpiricalFormulaForPeptideSequence(peptide.Code);

            var theorFeatureGenerator = new JoshTheorFeatureGenerator();

            theorFeatureGenerator.GenerateTheorFeature(peptide);
            var theorProfile     = peptide.IsotopicProfile;
            var theorIntensities = theorProfile.Peaklist.Select(p => (double)p.Height).ToList();

            Console.WriteLine("Total carbons = " + peptideUtils.GetNumAtomsForElement("C", peptide.EmpiricalFormula));


            var obsIntensities = new List <double>(new[]
            {
                1, 0.8335001, 0.4029815, 0.1846439, 0.1116047, 0.09458135, 0.07157851, 0.04972008,
                0.03036686, 0.01545749, 0.008299164, 0.004003931, 0.001711554, 0.000766305,
                0.000484514
            });


            var relexCorrectedIntensities = new List <double>(new[]
            {
                1, 0.84416, 0.4174013, 0.1843375, 0.1073706, 0.09557419, 0.07190877, 0.04823519,
                0.02991197, 0.01456759, 0.008299164, 0.004003931, 0.001711554, 0.000766305,
                0.000484514
            });


            /*
             *
             * Data for observed profile:
             * LCMSFeature 8517 from Yellow_C13_070_23Mar10_Griffin_10-01-28
             *              *
             * peak	mz	relIntens	width	sn
             *  0	770.418569278349	1	0.008119391	285.256
             *  1	770.919748892834	0.8335001	0.008161238	884.9909
             *  2	771.421020812818	0.4029815	0.008248929	566.6187
             *  3	771.922575912402	0.1846439	0.008058954	703.6938
             *  4	772.424544684666	0.1116047	0.007997629	358.0133
             *  5	772.926348484216	0.09458135	0.008128829	677.3434
             *  6	773.428080290323	0.07157851	0.008151106	100
             *  7	773.929769365137	0.04972008	0.008104968	100
             *  8	774.431542463583	0.03036686	0.007982519	100
             *  9	774.933237566856	0.01545749	0.008024476	100
             *  10	775.434950373045	0.008299164	0.008166174	740.9502
             *  11	775.936532837365	0.004003931	0.007899459	100
             *  12	776.438361528879	0.001711554	0.00877683	44.79652
             *  13	776.940072709136	0.0007663054	0.007601836	17.12788
             *  14	777.441663634739	0.0004845143	0.007320933	100
             *
             */


            var labelDistCalc = new LabelingDistributionCalculator();

            double[] solvedXVals;
            double[] solvedYvals;


            var d = 0.1;

            labelDistCalc.CalculateLabelingDistribution(theorIntensities, obsIntensities, d, d, out solvedXVals, out solvedYvals);


            var xydata = new XYData();

            xydata.Xvalues = solvedXVals;
            xydata.Yvalues = solvedYvals;

            Console.WriteLine();
            Console.WriteLine("threshold= " + d);
            xydata.Display();



            labelDistCalc.CalculateLabelingDistribution(theorIntensities, relexCorrectedIntensities, d, d, out solvedXVals, out solvedYvals);

            xydata.Xvalues = solvedXVals;
            xydata.Yvalues = solvedYvals;

            Console.WriteLine();
            Console.WriteLine("Relex-corrected isotopic profile= " + d);
            xydata.Display();


            double fractionUnlabelled, fractionLabelled, averageLabelsIncorporated;

            labelDistCalc.OutputLabelingInfo(solvedYvals.ToList(), out fractionUnlabelled, out fractionLabelled,
                                             out averageLabelsIncorporated);

            Console.WriteLine();
            Console.WriteLine("fractionUnlabelled= " + fractionUnlabelled);
            Console.WriteLine("fractionLabelled= " + fractionLabelled);
            Console.WriteLine("averageAmountLabelIncorp= " + averageLabelsIncorporated);



            //for (double d = 0; d < 2.1; d+=0.1)
            //{
            //    labelDistCalc.CalculateLabelingDistribution(theorIntensities, obsIntensities, d, d, out solvedXVals, out solvedYvals);


            //    XYData xydata = new XYData();
            //    xydata.Xvalues = solvedXVals;
            //    xydata.Yvalues = solvedYvals;

            //    Console.WriteLine();
            //    Console.WriteLine("threshold= " + d);
            //    xydata.Display();
            //}
        }
        public TargetCollection Import(List <int> TargetIDsToFilterOn)
        {
            var filterOnTargetIDs = TargetIDsToFilterOn != null && TargetIDsToFilterOn.Count > 0;

            var data = new TargetCollection();

            using (var reader = new StreamReader(m_filename))
            {
                var headerLine = reader.ReadLine();    //first line is the header line.

                _headers = processLine(headerLine);

                var lineCounter = 1;
                while (reader.Peek() != -1)
                {
                    var line = reader.ReadLine();
                    lineCounter++;



                    var lineData = processLine(line);

                    PeptideTarget massTag;
                    try
                    {
                        massTag = convertTextToMassTag(lineData);


                        if (filterOnTargetIDs)
                        {
                            if (!TargetIDsToFilterOn.Contains(massTag.ID))
                            {
                                continue;
                            }
                        }
                    }
                    catch (Exception ex)
                    {
                        var msg = "Importer failed. Error reading line: " + lineCounter.ToString() + "\nDetails: " + ex.Message;
                        throw new Exception(msg);
                    }


                    if (!massTag.ContainsMods && String.IsNullOrEmpty(massTag.EmpiricalFormula))
                    {
                        massTag.EmpiricalFormula = massTag.GetEmpiricalFormulaFromTargetCode();
                    }


                    var massTagMassInfoMissing = (Math.Abs(massTag.MonoIsotopicMass - 0) < double.Epsilon);

                    var chargeStateInfoIsAvailable = massTag.ChargeState != 0;
                    if (massTagMassInfoMissing)
                    {
                        if (!String.IsNullOrEmpty(massTag.EmpiricalFormula))
                        {
                            massTag.MonoIsotopicMass =
                                EmpiricalFormulaUtilities.GetMonoisotopicMassFromEmpiricalFormula(
                                    massTag.EmpiricalFormula);

                            if (chargeStateInfoIsAvailable)
                            {
                                massTag.MZ = massTag.MonoIsotopicMass / massTag.ChargeState + Globals.PROTON_MASS;
                            }
                        }
                    }


                    if (!chargeStateInfoIsAvailable)
                    {
                        double minMZToConsider = 400;
                        double maxMZToConsider = 1500;

                        var targetList = new List <PeptideTarget>();

                        for (var chargeState = 1; chargeState < 100; chargeState++)
                        {
                            var calcMZ = massTag.MonoIsotopicMass / chargeState + Globals.PROTON_MASS;
                            if (calcMZ > minMZToConsider && calcMZ < maxMZToConsider)
                            {
                                var copiedMassTag = new PeptideTarget(massTag);    //we need to create multiple mass tags
                                copiedMassTag.ChargeState = (short)chargeState;
                                copiedMassTag.MZ          = calcMZ;

                                targetList.Add(copiedMassTag);
                            }
                        }

                        data.TargetList.AddRange(targetList.Take(3));
                    }
                    else
                    {
                        data.TargetList.Add(massTag);
                    }
                }
            }

            foreach (PeptideTarget peptideTarget in data.TargetList)
            {
                //bool noNormalizedElutionTimeInfoAvailable = Math.Abs(peptideTarget.NormalizedElutionTime - -1) < Single.Epsilon;
                //if (noNormalizedElutionTimeInfoAvailable)
                //{
                //    peptideTarget.NormalizedElutionTime = 0.5f;
                //}
            }



            return(data);
        }
Exemplo n.º 21
0
        private void GetMassTagDataFromDB(TargetCollection data, IReadOnlyCollection <long> massTagsToBeRetrievedList)
        {
            var fact = DbProviderFactories.GetFactory("System.Data.SqlClient");

            var currentListPos = 0;

            using (var cnn = fact.CreateConnection())
            {
                if (cnn == null)
                {
                    throw new Exception("Factory.CreateConnection returned a null DbConnection object in GetMassTagDataFromDB");
                }

                cnn.ConnectionString = buildConnectionString();
                cnn.Open();

                var progressCounter = 0;
                while (currentListPos < massTagsToBeRetrievedList.Count)
                {
                    var nextGroupOfMassTagIDs = massTagsToBeRetrievedList.Skip(currentListPos).Take(ChunkSize).ToList();// GetRange(currentIndex, 5000);
                    currentListPos += (ChunkSize - 1);

                    var queryString = createQueryString(ImporterMode, nextGroupOfMassTagIDs);
                    //Console.WriteLine(queryString);

                    using (var command = cnn.CreateCommand())
                    {
                        command.CommandText    = queryString;
                        command.CommandTimeout = 120;
                        var reader = command.ExecuteReader();

                        while (reader.Read())
                        {
                            var massTag = new PeptideTarget();

                            progressCounter++;

                            if (!reader["Mass_Tag_ID"].Equals(DBNull.Value))
                            {
                                massTag.ID = Convert.ToInt32(reader["Mass_Tag_ID"]);
                            }
                            if (!reader["Monoisotopic_Mass"].Equals(DBNull.Value))
                            {
                                massTag.MonoIsotopicMass = Convert.ToDouble(reader["Monoisotopic_Mass"]);
                            }
                            if (!reader["Peptide"].Equals(DBNull.Value))
                            {
                                massTag.Code = Convert.ToString(reader["Peptide"]);
                            }
                            if (!reader["Charge_State"].Equals(DBNull.Value))
                            {
                                massTag.ChargeState = Convert.ToInt16(reader["Charge_State"]);
                            }
                            if (!reader["Mod_Count"].Equals(DBNull.Value))
                            {
                                massTag.ModCount = Convert.ToInt16(reader["Mod_Count"]);
                            }
                            if (!reader["Mod_Description"].Equals(DBNull.Value))
                            {
                                massTag.ModDescription = Convert.ToString(reader["Mod_Description"]);
                            }
                            if (!reader["ObsCount"].Equals(DBNull.Value))
                            {
                                massTag.ObsCount = Convert.ToInt32(reader["ObsCount"]);
                            }
                            if (massTag.ChargeState != 0)
                            {
                                massTag.MZ = massTag.MonoIsotopicMass / massTag.ChargeState + Globals.PROTON_MASS;
                            }

                            if (!reader["Avg_GANET"].Equals(DBNull.Value))
                            {
                                massTag.NormalizedElutionTime = Convert.ToSingle(reader["Avg_GANET"]);
                            }
                            if (!reader["Ref_ID"].Equals(DBNull.Value))
                            {
                                massTag.RefID = Convert.ToInt32(reader["Ref_ID"]);
                            }
                            if (!reader["Reference"].Equals(DBNull.Value))
                            {
                                massTag.GeneReference = Convert.ToString(reader["Reference"]);
                            }
                            if (!reader["Description"].Equals(DBNull.Value))
                            {
                                massTag.ProteinDescription = Convert.ToString(reader["Description"]);
                            }

                            data.TargetList.Add(massTag);

                            if (progressCounter % 100 == 0)
                            {
                                Console.WriteLine(progressCounter + " records loaded; " + reader[0]);
                            }
                        }
                        reader.Close();
                    }
                }
            }
        }
Exemplo n.º 22
0
        public override void Deconvolute(ResultCollection resultList)
        {
            float[] xvals = new float[1];
            float[] yvals = new float[1];
            resultList.Run.XYData.GetXYValuesAsSingles(ref xvals, ref yvals);

            int sizeOfRapidArray = 10000;

            int[]    chargeResults           = new int[sizeOfRapidArray];
            double[] intensityResults        = new double[sizeOfRapidArray];
            double[] mzResults               = new double[sizeOfRapidArray];
            double[] scoreResults            = new double[sizeOfRapidArray];
            double[] avgmassResults          = new double[sizeOfRapidArray];
            double[] massResults             = new double[sizeOfRapidArray];
            double[] mostAbundantMassResults = new double[sizeOfRapidArray];

            if (resultList.Run.PeakList == null || resultList.Run.PeakList.Count == 0)
            {
                return;
            }

            rapidPeakList = ConvertPeakListToRapidPeakList(resultList.Run.PeakList);
            if (rapidPeakList == null || rapidPeakList.Length == 0)
            {
                return;
            }

            double rapidsBackgroundIntensityParameter = (resultList.Run.CurrentBackgroundIntensity * minPeptideToBackgroundRatio);

            Transformer.PerformTransform_cluster(Convert.ToSingle(rapidsBackgroundIntensityParameter),
                                                 ref xvals, ref yvals, ref rapidPeakList, ref chargeResults,
                                                 ref intensityResults, ref mzResults, ref scoreResults, ref avgmassResults,
                                                 ref massResults, ref mostAbundantMassResults);

            GenerateResults(resultList, ref chargeResults, ref intensityResults,
                            ref mzResults, ref scoreResults,
                            ref avgmassResults, ref massResults,
                            ref mostAbundantMassResults, this.resultCombiningMode);

            if (this.IsNewFitCalculationPerformed)
            {
                //HACK:  RAPID doesn't return the peaks of the isotopic profile. And it's score is meaningless. So will iterate over
                //the results and 1) get the peaks of the isotopic profile  and  2) get a least-squares fit of the isotopic profile.
                foreach (IsosResult result in resultList.IsosResultBin)
                {
                    //create a temporary mass tag, as a data object for storing relevent info, and using the CalculateMassesForIsotopicProfile() method.
                    PeptideTarget mt = new PeptideTarget();

                    mt.ChargeState      = (short)result.IsotopicProfile.ChargeState;
                    mt.MonoIsotopicMass = result.IsotopicProfile.MonoIsotopicMass;
                    mt.MZ = (mt.MonoIsotopicMass / mt.ChargeState) + Globals.PROTON_MASS;

                    mt.EmpiricalFormula = _TomIsotopicPatternCreator.GetClosestAvnFormula(result.IsotopicProfile.MonoIsotopicMass, false);

                    mt.IsotopicProfile = _TomIsotopicPatternCreator.GetIsotopePattern(mt.EmpiricalFormula, _TomIsotopicPatternCreator.aafIsos);
                    mt.CalculateMassesForIsotopicProfile(mt.ChargeState);

                    double toleranceInPPM = calcToleranceInPPMFromIsotopicProfile(result.IsotopicProfile);

                    //this finds the isotopic profile based on the theor. isotopic profile.
                    BasicTFF bff = new BasicTFF(toleranceInPPM, false);

                    IsotopicProfile iso = bff.FindMSFeature(resultList.Run.PeakList, mt.IsotopicProfile);

                    if (iso != null && iso.Peaklist != null && iso.Peaklist.Count > 1)
                    {
                        //start at the second peak... and add the newly found peaks
                        for (int i = 1; i < iso.Peaklist.Count; i++)
                        {
                            result.IsotopicProfile.Peaklist.Add(iso.Peaklist[i]);
                        }

                        //now that we have the peaks, we can get info for MonoPlusTwoAbundance
                        result.IsotopicProfile.MonoPlusTwoAbundance = result.IsotopicProfile.GetMonoPlusTwoAbundance();
                    }

                    XYData theorXYData = mt.IsotopicProfile.GetTheoreticalIsotopicProfileXYData(result.IsotopicProfile.GetFWHM());

                    //offset the theor isotopic profile
                    offsetDistribution(theorXYData, mt.IsotopicProfile, result.IsotopicProfile);

                    AreaFitter areafitter = new AreaFitter();
                    int        ionCountUsed;
                    double     fitval = areafitter.GetFit(theorXYData, result.Run.XYData, 0.1, out ionCountUsed);

                    if (fitval == double.NaN || fitval > 1)
                    {
                        fitval = 1;
                    }

                    result.IsotopicProfile.Score = fitval;
                }
            }
        }
Exemplo n.º 23
0
        public void GetUnsummedIntensitiesAndDetectSaturation(Run run, IEnumerable <IsosResult> resultList)
        {
            Check.Require(run != null, "SaturationDetector failed. Run is null");
            if (run == null)
            {
                return;
            }

            if (_msGenerator == null)
            {
                _msGenerator = MSGeneratorFactory.CreateMSGenerator(run.MSFileType);
            }

            if (run is UIMFRun uimfRun)
            {
                if (uimfRun.CurrentScanSet == null)
                {
                    throw new NullReferenceException("CurrentScanSet is null. You need to set it.");
                }
                if (uimfRun.CurrentIMSScanSet == null)
                {
                    throw new NullReferenceException("CurrentIMSScanSet is null. You need to set it.");
                }

                //this creates a FrameSet containing only the primary frame.  Therefore no summing will occur
                var lcScanSet = new ScanSet(uimfRun.CurrentScanSet.PrimaryScanNumber);

                //this creates a ScanSet containing only the primary scan.  Therefore no summing will occur
                var imsScanSet = new IMSScanSet(uimfRun.CurrentIMSScanSet.PrimaryScanNumber);

                //get the mass spectrum +/- 5 da from the range of the isotopicProfile

                uimfRun.CurrentScanSet    = lcScanSet;
                uimfRun.CurrentIMSScanSet = imsScanSet;
                _msGenerator.Execute(run.ResultCollection);
            }
            else
            {
                if (run.CurrentScanSet == null)
                {
                    throw new NullReferenceException("CurrentScanSet is null. You need to set it.");
                }

                //this creates a ScanSet containing only the primary scan.  Therefore no summing will occur
                var scanSet = new ScanSet(run.CurrentScanSet.PrimaryScanNumber);

                run.CurrentScanSet = scanSet;

                _msGenerator.Execute(run.ResultCollection);
            }

            foreach (var result in resultList)
            {
                var indexOfObsMostAbundant = result.IsotopicProfile.GetIndexOfMostIntensePeak();

                var mzOfMostAbundant = result.IsotopicProfile.Peaklist[indexOfObsMostAbundant].XValue;

                var indexOfUnsummedMostAbundantMZ = run.XYData.GetClosestXVal(mzOfMostAbundant);
                if (indexOfUnsummedMostAbundantMZ >= 0)
                {
                    result.IsotopicProfile.OriginalIntensity = run.XYData.Yvalues[indexOfUnsummedMostAbundantMZ];
                    result.IsotopicProfile.IsSaturated       = (result.IsotopicProfile.OriginalIntensity >=
                                                                SaturationThreshold);

                    if (result.IsotopicProfile.IsSaturated)
                    {
                        //problem is that with these saturated profiles, they are often truncated because another
                        //isotopic profile was falsely assigned to the back end of it. So we need to find more peaks that should
                        //belong to the saturated profile.
                        var theorTarget = new PeptideTarget
                        {
                            ChargeState      = (short)result.IsotopicProfile.ChargeState,
                            MonoIsotopicMass = result.IsotopicProfile.MonoIsotopicMass
                        };

                        theorTarget.MZ = (theorTarget.MonoIsotopicMass / theorTarget.ChargeState) + Globals.PROTON_MASS;

                        var averagineFormula = _tomIsotopicPatternGenerator.GetClosestAvnFormula(result.IsotopicProfile.MonoIsotopicMass, false);
                        theorTarget.IsotopicProfile  = _tomIsotopicPatternGenerator.GetIsotopePattern(averagineFormula, _tomIsotopicPatternGenerator.aafIsos);
                        theorTarget.EmpiricalFormula = averagineFormula;
                        theorTarget.CalculateMassesForIsotopicProfile(result.IsotopicProfile.ChargeState);

                        AssignMissingPeaksToSaturatedProfile(run.PeakList, result.IsotopicProfile, theorTarget.IsotopicProfile);

                        //goal is to find the index of the isotopic profile peaks of a peak that is not saturated

                        var indexOfGoodUnsaturatedPeak = -1;

                        for (var i = indexOfObsMostAbundant + 1; i < result.IsotopicProfile.Peaklist.Count; i++)
                        {
                            var indexUnsummedData = run.XYData.GetClosestXVal(result.IsotopicProfile.Peaklist[i].XValue);

                            var unsummedIntensity = run.XYData.Yvalues[indexUnsummedData];

                            if (unsummedIntensity < _minRelIntTheorProfile * SaturationThreshold)
                            {
                                indexOfGoodUnsaturatedPeak = i;
                                break;
                            }
                        }

                        AdjustSaturatedIsotopicProfile(result.IsotopicProfile, theorTarget.IsotopicProfile,
                                                       indexOfGoodUnsaturatedPeak);
                    }
                }

                //double summedIntensity = 0;
                //foreach (MSPeak peak in result.IsotopicProfile.Peaklist)
                //{
                //    int indexOfMZ = result.Run.XYData.GetClosestXVal(peak.XValue);
                //    if (indexOfMZ >= 0)
                //    {
                //        summedIntensity += result.Run.XYData.Yvalues[indexOfMZ];
                //    }
                //}

                //result.IsotopicProfile.OriginalTotalIsotopicAbundance = summedIntensity;
            }
        }