Esempio n. 1
0
        public void TestCompositeScoring()
        {
            var methodName = MethodBase.GetCurrentMethod().Name;
            TestUtils.ShowStarting(methodName);

            //const string rawFilePath = @"\\proto-2\UnitTest_Files\InformedProteomics_TestFiles\SpecFiles\QC_Shew_Intact_26Sep14_Bane_C2Column3.raw";
            const string rawFilePath = @"D:\MassSpecFiles\training\raw\QC_Shew_Intact_26Sep14_Bane_C2Column3.pbf";

            if (!File.Exists(rawFilePath))
            {
                Assert.Ignore(@"Skipping test {0} since file not found: {1}", methodName, rawFilePath);
            }

            // Configure amino acid set
            var oxM = new SearchModification(Modification.Oxidation, 'M', SequenceLocation.Everywhere, false);
            var dehydroC = new SearchModification(Modification.Dehydro, 'C', SequenceLocation.Everywhere, false);
            var acetylN = new SearchModification(Modification.Acetylation, '*', SequenceLocation.ProteinNTerm, false);

            const int numMaxModsPerProtein = 4;
            var searchModifications = new List<SearchModification>
            {
                dehydroC,
                oxM,
                acetylN
            };
            var aaSet = new AminoAcidSet(searchModifications, numMaxModsPerProtein);
            var comparer = new FilteredProteinMassBinning(aaSet, 50000, 28);

            var run = PbfLcMsRun.GetLcMsRun(rawFilePath);
            const double filteringWindowSize = 1.1;
            const int isotopeOffsetTolerance = 2;
            var tolerance = new Tolerance(10);
            const int minCharge = 1;
            const int maxCharge = 20;
            var graphFactory = new ProteinScoringGraphFactory(comparer, aaSet);
            var aminoAcidSet = new AminoAcidSet();
            //var scorer = new MatchedPeakPostScorer(tolerance, minCharge, maxCharge);
            var scorer = new InformedTopDownScorer(run, aminoAcidSet, minCharge, maxCharge, tolerance);

            var fileExt = new string[] {"IcTarget", "IcDecoy"};
            foreach (var ext in fileExt)
            {
                var resultFileName = string.Format(@"D:\MassSpecFiles\training\Rescoring\QC_Shew_Intact_26Sep14_Bane_C2Column3_{0}.tsv", ext);
                var parser = new TsvFileParser(resultFileName);
                var scans = parser.GetData("Scan").Select(s => Convert.ToInt32(s)).ToArray();
                var charges = parser.GetData("Charge").Select(s => Convert.ToInt32(s)).ToArray();
                var protSequences = parser.GetData("Sequence").ToArray();
                var modStrs = parser.GetData("Modifications").ToArray();
                var compositions = parser.GetData("Composition").Select(Composition.Parse).ToArray();
                var protMass = parser.GetData("Mass").Select(s => Convert.ToDouble(s)).ToArray();
                var outputFileName = string.Format(@"D:\MassSpecFiles\training\Rescoring\QC_Shew_Intact_26Sep14_Bane_C2Column3_{0}_Rescored.tsv", ext);

                using (var writer = new StreamWriter(outputFileName))
                {
                    writer.WriteLine(string.Join("\t", parser.GetHeaders().ToArray(), 0, 15) + "\tScore\tEValue");

                    var lines = new string[parser.NumData];
                    
                    //for (var i = 0; i < parser.NumData; i++)
                    Parallel.For(0, parser.NumData, i =>
                    {
                        var scan = scans[i];
                        var charge = charges[i];
                        var protSequence = protSequences[i];
                        var modStr = modStrs[i];
                        var sequence = Sequence.CreateSequence(protSequence, modStr, aminoAcidSet);
                        Assert.True(sequence.Composition.Equals(compositions[i] - Composition.H2O));
                        var ms2Spec = run.GetSpectrum(scan) as ProductSpectrum;
                        Assert.True(ms2Spec != null);
                        var scores = scorer.GetScores(sequence, charge, scan);

                        var deconvSpec = Deconvoluter.GetDeconvolutedSpectrum(ms2Spec, minCharge, maxCharge,
                            isotopeOffsetTolerance, filteringWindowSize, tolerance, 0.7);

                        var deconvScorer = new CompositeScorerBasedOnDeconvolutedSpectrum(deconvSpec, ms2Spec, tolerance,
                            comparer);
                        var graph = graphFactory.CreateScoringGraph(deconvScorer, protMass[i]);

                        var gf = new GeneratingFunction(graph);
                        gf.ComputeGeneratingFunction();

                        var specEvalue = gf.GetSpectralEValue(scores.Score);

                        var rowStr = parser.GetRows()[i];
                        var items = rowStr.Split('\t').ToArray();
                        var newRowStr = string.Join("\t", items, 0, 15);

                        //writer.WriteLine("{0}\t{1}\t{2}", newRowStr, scores.Score, specEvalue);
                        lock (lines)
                        {
                            lines[i] = string.Format("{0}\t{1}\t{2}", newRowStr, scores.Score, specEvalue);    
                        }
                        //Console.WriteLine("{0}\t{1}\t{2}", items[0], scores.Score, specEvalue);
                    });

                    foreach (var line in lines) writer.WriteLine(line);
                }
                Console.WriteLine("Done");
            }
        }
Esempio n. 2
0
        private DatabaseSequenceSpectrumMatch[] RunGeneratingFunction(SortedSet<DatabaseSequenceSpectrumMatch>[] sortedMatches, CancellationToken? cancellationToken = null, IProgress<ProgressData> progress = null)
        {
            var progData = new ProgressData(progress)
            {
                Status = "Calculating spectral E-values for matches"
            };

            if (_cachedScoreDistributions == null)
            {
                _cachedScoreDistributions = new LinkedList<Tuple<double, ScoreDistribution>>[_run.MaxLcScan + 1];
                foreach (var scanNum in _ms2ScanNums) _cachedScoreDistributions[scanNum] = new LinkedList<Tuple<double, ScoreDistribution>>();
            }
            
            var sw = new Stopwatch();

            var topDownScorer = new InformedTopDownScorer(_run, AminoAcidSet, MinProductIonCharge, MaxProductIonCharge, ProductIonTolerance);

            // Rescore and Estimate #proteins for GF calculation
            var matches = new LinkedList<DatabaseSequenceSpectrumMatch>[sortedMatches.Length];
            long estimatedProteins = 0;
            foreach(var scanNum in _ms2ScanNums)
            {
                var prsms = sortedMatches[scanNum];
                if (prsms == null) continue;
                var spec = _run.GetSpectrum(scanNum) as ProductSpectrum;
                if (spec == null) return null;

                foreach (var match in prsms)
                {
                    var sequence = match.Sequence;
                    var ion = match.Ion;

                    // Re-scoring
                    var scores = topDownScorer.GetScores(spec, sequence, ion.Composition, ion.Charge, scanNum);
                    if (scores == null) continue;
                    
                    match.Score = scores.Score;
                    match.ModificationText = scores.Modifications;
                    match.NumMatchedFragments = scores.NumMatchedFrags;
                    if (match.Score > CompositeScorer.ScoreParam.Cutoff)
                    {
                        if (matches[scanNum] == null) matches[scanNum] = new LinkedList<DatabaseSequenceSpectrumMatch>();
                        matches[scanNum].AddLast(match);
                    }
                }

                if (matches[scanNum] != null) estimatedProteins += matches[scanNum].Count;
            }

            Console.WriteLine(@"Estimated matched proteins: " + estimatedProteins);

            var numProteins = 0;
            var lastUpdate = DateTime.MinValue; // Force original update of 0%
            sw.Reset();
            sw.Start();

            var scanNums = _ms2ScanNums.Where(scanNum => matches[scanNum] != null).ToArray();

            var pfeOptions = new ParallelOptions
            {
                MaxDegreeOfParallelism = MaxNumThreads,
                CancellationToken = cancellationToken ?? CancellationToken.None
            };
            Parallel.ForEach(scanNums, pfeOptions, scanNum =>
            {
                var currentTask = "?";
                try
                {
                    var scoreDistributions = _cachedScoreDistributions[scanNum];
                    foreach (var match in matches[scanNum])
                    {
                        var currentIteration = "for scan " + scanNum + " and mass " + match.Ion.Composition.Mass;
                        currentTask = "Calling GetMs2ScoringGraph " + currentIteration;

                        var graph = _ms2ScorerFactory2.GetMs2ScoringGraph(scanNum, match.Ion.Composition.Mass);
                        if (graph == null) continue;

                        currentTask = "Calling ComputeGeneratingFunction " + currentIteration;

                        var scoreDist = (from distribution in scoreDistributions
                                         where Math.Abs(distribution.Item1 - match.Ion.Composition.Mass) < PrecursorIonTolerance.GetToleranceAsTh(match.Ion.Composition.Mass)
                                         select distribution.Item2).FirstOrDefault();
                        if (scoreDist == null)
                        {
                            var gf = new GeneratingFunction(graph);
                            gf.ComputeGeneratingFunction();
                            scoreDist = gf.GetScoreDistribution();
                            scoreDistributions.AddLast(new Tuple<double, ScoreDistribution>(match.Ion.Composition.Mass, scoreDist));
                        }

                        currentTask = "Calling GetSpectralEValue " + currentIteration + " and score " + (int)match.Score;
                        match.SpecEvalue = scoreDist.GetSpectralEValue(match.Score);

                        currentTask = "Reporting progress " + currentIteration;
                        SearchProgressReport(ref numProteins, ref lastUpdate, estimatedProteins, sw, progData);
                    }
                }
                catch (Exception ex)
                {
                    var errMsg = string.Format("Exception while {0}: {1}", currentTask, ex.Message);
                    Console.WriteLine(errMsg);
                    throw new Exception(errMsg, ex);
                }
            });
            
            var finalMatches = new DatabaseSequenceSpectrumMatch[matches.Length];
            foreach (var scanNum in scanNums)
            {
                finalMatches[scanNum] = matches[scanNum].OrderBy(m => m.SpecEvalue).First();
            }
            
            progData.StatusInternal = string.Empty;
            progData.Report(100.0);
            return finalMatches;
        }
Esempio n. 3
0
        public void TestGetScoreDistribution()
        {
            var methodName = MethodBase.GetCurrentMethod().Name;
            TestUtils.ShowStarting(methodName);
            const string rawFile = @"D:\MassSpecFiles\training\raw\QC_Shew_Intact_26Sep14_Bane_C2Column3.pbf";
            const string idFileFolder = @"D:\MassSpecFiles\training\IdScoring\MSPF_trainset";

            const int scanNum = 5927;
            const string protSequence = "MNKSELIEKIASGADISKAAAGRALDSFIAAVTEGLKEGDKISLVGFGTFEVRERAERTGRNPQTGEEIKIAAAKIPAFKAGKALKDAVN";
            
            const string modStr = "";

            var idFile = string.Format(@"{0}\QC_Shew_Intact_26Sep14_Bane_C2Column3_IcTda.tsv", idFileFolder);
            if (!File.Exists(idFile)) return;
            //Console.WriteLine(dataset);

            if (!File.Exists(rawFile))
            {
                Assert.Ignore(@"Skipping test {0} since file not found: {1}", methodName, rawFile);
            }


            const int maxCharge = 20;
            const int minCharge = 1;
            const double filteringWindowSize = 1.1;
            const int isotopeOffsetTolerance = 2;
            var tolerance = new Tolerance(10);
            var run = PbfLcMsRun.GetLcMsRun(rawFile);

            // Configure amino acid set
            var oxM = new SearchModification(Modification.Oxidation, 'M', SequenceLocation.Everywhere, false);
            var dehydroC = new SearchModification(Modification.Dehydro, 'C', SequenceLocation.Everywhere, false);
            var acetylN = new SearchModification(Modification.Acetylation, '*', SequenceLocation.ProteinNTerm, false);

            const int numMaxModsPerProtein = 4;
            var searchModifications = new List<SearchModification>
            {
                dehydroC,
                oxM,
                acetylN
            };
            var aaSet = new AminoAcidSet(searchModifications, numMaxModsPerProtein);
            var comparer = new FilteredProteinMassBinning(aaSet, 50000, 28);
            //Console.WriteLine("{0}\t{1}", comparer.NumberOfBins, comparer.GetBinNumber(proteinMass));

            var stopwatch = Stopwatch.StartNew();
            var graphFactory = new ProteinScoringGraphFactory(comparer, aaSet);
            stopwatch.Stop();
            Console.WriteLine(@"edge generation elapsed time = {0:0.000} sec", (stopwatch.ElapsedMilliseconds) / 1000.0d);

            var n = 0;
            var stopwatch2 = Stopwatch.StartNew();

            var sequence = Sequence.CreateSequence(protSequence, modStr, aaSet);
            var proteinMass = sequence.Mass + Composition.H2O.Mass;

                Console.WriteLine("Mass = {0}", proteinMass);

                var spectrum = run.GetSpectrum(scanNum) as ProductSpectrum;
                var deconvSpec = Deconvoluter.GetDeconvolutedSpectrum(spectrum, minCharge, maxCharge,
                    isotopeOffsetTolerance, filteringWindowSize, tolerance, 0.7);

                stopwatch.Restart();

                var scorer = new CompositeScorerBasedOnDeconvolutedSpectrum(deconvSpec, spectrum, tolerance, comparer);
                var graph = graphFactory.CreateScoringGraph(scorer, proteinMass);
                stopwatch.Stop();
                Console.WriteLine(@"node generation elapsed time = {0:0.000} sec", (stopwatch.ElapsedMilliseconds) / 1000.0d);
                
                stopwatch.Reset();
                stopwatch.Start();
                var gf = new GeneratingFunction(graph);
                gf.ComputeGeneratingFunction();
                //gf.ComputeGeneratingFunction(graph);
                stopwatch.Stop();
                Console.WriteLine(@"computing generation function = {0:0.000} sec", (stopwatch.ElapsedMilliseconds) / 1000.0d);
                var scoreDist = gf.GetScoreDistribution();

                Console.WriteLine("{0}-{1}", scoreDist.MinScore, scoreDist.MaxScore);
                
                for (var score = 45; score <= gf.MaximumScore; score++)
                {
                    var specEvalue = gf.GetSpectralEValue(score);
                    Console.WriteLine("{0} : {1}", score, specEvalue);
                }
               
            stopwatch2.Stop();
            Console.WriteLine(@"TOTAL computing generation function = {0:0.000} sec", (stopwatch2.ElapsedMilliseconds) / 1000.0d);
        }