Esempio n. 1
0
        public void TestCompositeScoring()
        {
            var methodName = MethodBase.GetCurrentMethod().Name;

            TestUtils.ShowStarting(methodName);

            //const string rawFilePath = @"\\proto-2\UnitTest_Files\InformedProteomics_TestFiles\SpecFiles\QC_Shew_Intact_26Sep14_Bane_C2Column3.raw";
            const string rawFilePath = @"D:\MassSpecFiles\training\raw\QC_Shew_Intact_26Sep14_Bane_C2Column3.pbf";

            if (!File.Exists(rawFilePath))
            {
                Assert.Ignore(@"Skipping test {0} since file not found: {1}", methodName, rawFilePath);
            }

            // Configure amino acid set
            var oxM      = new SearchModification(Modification.Oxidation, 'M', SequenceLocation.Everywhere, false);
            var dehydroC = new SearchModification(Modification.Dehydro, 'C', SequenceLocation.Everywhere, false);
            var acetylN  = new SearchModification(Modification.Acetylation, '*', SequenceLocation.ProteinNTerm, false);

            const int numMaxModsPerProtein = 4;
            var       searchModifications  = new List <SearchModification>
            {
                dehydroC,
                oxM,
                acetylN
            };
            var aaSet    = new AminoAcidSet(searchModifications, numMaxModsPerProtein);
            var comparer = new FilteredProteinMassBinning(aaSet, 50000, 28);

            var          run = PbfLcMsRun.GetLcMsRun(rawFilePath);
            const double filteringWindowSize    = 1.1;
            const int    isotopeOffsetTolerance = 2;
            var          tolerance    = new Tolerance(10);
            const int    minCharge    = 1;
            const int    maxCharge    = 20;
            var          graphFactory = new ProteinScoringGraphFactory(comparer, aaSet);
            var          aminoAcidSet = new AminoAcidSet();
            //var scorer = new MatchedPeakPostScorer(tolerance, minCharge, maxCharge);
            var scorer = new InformedTopDownScorer(run, aminoAcidSet, minCharge, maxCharge, tolerance);

            var fileExt = new string[] { "IcTarget", "IcDecoy" };

            foreach (var ext in fileExt)
            {
                var resultFileName = string.Format(@"D:\MassSpecFiles\training\Rescoring\QC_Shew_Intact_26Sep14_Bane_C2Column3_{0}.tsv", ext);
                var parser         = new TsvFileParser(resultFileName);
                var scans          = parser.GetData("Scan").Select(s => Convert.ToInt32(s)).ToArray();
                var charges        = parser.GetData("Charge").Select(s => Convert.ToInt32(s)).ToArray();
                var protSequences  = parser.GetData("Sequence").ToArray();
                var modStrs        = parser.GetData("Modifications").ToArray();
                var compositions   = parser.GetData("Composition").Select(Composition.Parse).ToArray();
                var protMass       = parser.GetData("Mass").Select(s => Convert.ToDouble(s)).ToArray();
                var outputFileName = string.Format(@"D:\MassSpecFiles\training\Rescoring\QC_Shew_Intact_26Sep14_Bane_C2Column3_{0}_Rescored.tsv", ext);

                using (var writer = new StreamWriter(outputFileName))
                {
                    writer.WriteLine(string.Join("\t", parser.GetHeaders().ToArray(), 0, 15) + "\tScore\tEValue");

                    var lines = new string[parser.NumData];

                    //for (var i = 0; i < parser.NumData; i++)
                    Parallel.For(0, parser.NumData, i =>
                    {
                        var scan         = scans[i];
                        var charge       = charges[i];
                        var protSequence = protSequences[i];
                        var modStr       = modStrs[i];
                        var sequence     = Sequence.CreateSequence(protSequence, modStr, aminoAcidSet);
                        Assert.True(sequence.Composition.Equals(compositions[i] - Composition.H2O));
                        var ms2Spec = run.GetSpectrum(scan) as ProductSpectrum;
                        Assert.True(ms2Spec != null);
                        var scores = scorer.GetScores(sequence, charge, scan);

                        var deconvSpec = Deconvoluter.GetDeconvolutedSpectrum(ms2Spec, minCharge, maxCharge,
                                                                              isotopeOffsetTolerance, filteringWindowSize, tolerance, 0.7);

                        var deconvScorer = new CompositeScorerBasedOnDeconvolutedSpectrum(deconvSpec, ms2Spec, tolerance,
                                                                                          comparer);
                        var graph = graphFactory.CreateScoringGraph(deconvScorer, protMass[i]);

                        var gf = new GeneratingFunction(graph);
                        gf.ComputeGeneratingFunction();

                        var specEvalue = gf.GetSpectralEValue(scores.Score);

                        var rowStr    = parser.GetRows()[i];
                        var items     = rowStr.Split('\t').ToArray();
                        var newRowStr = string.Join("\t", items, 0, 15);

                        //writer.WriteLine("{0}\t{1}\t{2}", newRowStr, scores.Score, specEvalue);
                        lock (lines)
                        {
                            lines[i] = string.Format("{0}\t{1}\t{2}", newRowStr, scores.Score, specEvalue);
                        }
                        //Console.WriteLine("{0}\t{1}\t{2}", items[0], scores.Score, specEvalue);
                    });

                    foreach (var line in lines)
                    {
                        writer.WriteLine(line);
                    }
                }
                Console.WriteLine("Done");
            }
        }
Esempio n. 2
0
        public void TestCompositeScoring()
        {
            var methodName = MethodBase.GetCurrentMethod().Name;

            Utils.ShowStarting(methodName);

            var pbfFilePath = Utils.GetPbfTestFilePath(false);
            var pbfFile     = Utils.GetTestFile(methodName, pbfFilePath);

            // Configure amino acid set
            var oxM      = new SearchModification(Modification.Oxidation, 'M', SequenceLocation.Everywhere, false);
            var dehydroC = new SearchModification(Modification.Dehydro, 'C', SequenceLocation.Everywhere, false);
            var acetylN  = new SearchModification(Modification.Acetylation, '*', SequenceLocation.ProteinNTerm, false);

            const int numMaxModsPerProtein = 4;
            var       searchModifications  = new List <SearchModification>
            {
                dehydroC,
                oxM,
                acetylN
            };
            var aaSet    = new AminoAcidSet(searchModifications, numMaxModsPerProtein);
            var comparer = new FilteredProteinMassBinning(aaSet, 50000, 28);

            var          run = PbfLcMsRun.GetLcMsRun(pbfFile.FullName);
            const double filteringWindowSize    = 1.1;
            const int    isotopeOffsetTolerance = 2;
            var          tolerance    = new Tolerance(10);
            const int    minCharge    = 1;
            const int    maxCharge    = 20;
            var          graphFactory = new ProteinScoringGraphFactory(comparer, aaSet);
            var          aminoAcidSet = new AminoAcidSet();
            //var scorer = new MatchedPeakPostScorer(tolerance, minCharge, maxCharge);
            var scorer = new InformedTopDownScorer(run, aminoAcidSet, minCharge, maxCharge, tolerance);

            if (pbfFile.DirectoryName == null)
            {
                Assert.Ignore("Ignoring test since cannot determine the parent directory of " + pbfFile.FullName);
            }

            var fileExt = new[] { "IcTarget", "IcDecoy" };

            foreach (var ext in fileExt)
            {
                var resultFileName = Path.Combine(pbfFile.DirectoryName, Path.GetFileNameWithoutExtension(pbfFile.Name)) + string.Format("_{0}.tsv", ext);
                var parser         = new TsvFileParser(resultFileName);
                var scans          = parser.GetData("Scan").Select(s => Convert.ToInt32(s)).ToArray();
                var charges        = parser.GetData("Charge").Select(s => Convert.ToInt32(s)).ToArray();
                var protSequences  = parser.GetData("Sequence").ToArray();
                var modStrs        = parser.GetData("Modifications").ToArray();
                var compositions   = parser.GetData("Composition").Select(Composition.Parse).ToArray();
                var protMass       = parser.GetData("Mass").Select(s => Convert.ToDouble(s)).ToArray();

                var outputFileName = Path.Combine(pbfFile.DirectoryName, Path.GetFileNameWithoutExtension(pbfFile.Name)) + string.Format("_{0}_Rescored.tsv", ext);

                using (var writer = new StreamWriter(outputFileName))
                {
                    writer.WriteLine(string.Join("\t", parser.GetHeaders().ToArray(), 0, 15) + "\tScore\tEValue");

                    var lines = new string[parser.NumData];

                    //for (var i = 0; i < parser.NumData; i++)
                    Parallel.For(0, 30, i =>
                    {
                        var scan         = scans[i];
                        var charge       = charges[i];
                        var protSequence = protSequences[i];
                        var modStr       = modStrs[i];
                        var sequence     = Sequence.CreateSequence(protSequence, modStr, aminoAcidSet);
                        // Assert.True(sequence.Composition.Equals(compositions[i] - Composition.H2O));

                        if (!(run.GetSpectrum(scan) is ProductSpectrum ms2Spec))
                        {
                            Console.WriteLine("Could not get the spectrum datafor scan {0}", scan);
                        }
Esempio n. 3
0
        public void TestCompositeScoring()
        {
            var methodName = MethodBase.GetCurrentMethod().Name;

            Utils.ShowStarting(methodName);

            var pbfFilePath = Utils.GetPbfTestFilePath(false);
            var pbfFile     = Utils.GetTestFile(methodName, pbfFilePath);

            // Configure amino acid set
            var oxM      = new SearchModification(Modification.Oxidation, 'M', SequenceLocation.Everywhere, false);
            var dehydroC = new SearchModification(Modification.Dehydro, 'C', SequenceLocation.Everywhere, false);
            var acetylN  = new SearchModification(Modification.Acetylation, '*', SequenceLocation.ProteinNTerm, false);

            const int numMaxModsPerProtein = 4;
            var       searchModifications  = new List <SearchModification>
            {
                dehydroC,
                oxM,
                acetylN
            };
            var aaSet    = new AminoAcidSet(searchModifications, numMaxModsPerProtein);
            var comparer = new FilteredProteinMassBinning(aaSet, 50000, 28);

            var          run = PbfLcMsRun.GetLcMsRun(pbfFile.FullName);
            const double filteringWindowSize    = 1.1;
            const int    isotopeOffsetTolerance = 2;
            var          tolerance    = new Tolerance(10);
            const int    minCharge    = 1;
            const int    maxCharge    = 20;
            var          graphFactory = new ProteinScoringGraphFactory(comparer, aaSet);
            var          aminoAcidSet = new AminoAcidSet();
            //var scorer = new MatchedPeakPostScorer(tolerance, minCharge, maxCharge);
            var scorer = new InformedTopDownScorer(run, aminoAcidSet, minCharge, maxCharge, tolerance);

            if (pbfFile.DirectoryName == null)
            {
                Assert.Ignore("Ignoring test since cannot determine the parent directory of " + pbfFile.FullName);
            }

            var fileExt = new string[] { "IcTarget", "IcDecoy" };

            foreach (var ext in fileExt)
            {
                var resultFileName = Path.Combine(pbfFile.DirectoryName, Path.GetFileNameWithoutExtension(pbfFile.Name)) + string.Format("_{0}.tsv", ext);
                var parser         = new TsvFileParser(resultFileName);
                var scans          = parser.GetData("Scan").Select(s => Convert.ToInt32((string)s)).ToArray();
                var charges        = parser.GetData("Charge").Select(s => Convert.ToInt32(s)).ToArray();
                var protSequences  = parser.GetData("Sequence").ToArray();
                var modStrs        = parser.GetData("Modifications").ToArray();
                var compositions   = parser.GetData("Composition").Select(Composition.Parse).ToArray();
                var protMass       = parser.GetData("Mass").Select(s => Convert.ToDouble(s)).ToArray();

                var outputFileName = Path.Combine(pbfFile.DirectoryName, Path.GetFileNameWithoutExtension(pbfFile.Name)) + string.Format("_{0}_Rescored.tsv", ext);

                using (var writer = new StreamWriter(outputFileName))
                {
                    writer.WriteLine(string.Join("\t", parser.GetHeaders().ToArray(), 0, 15) + "\tScore\tEValue");

                    var lines = new string[parser.NumData];

                    //for (var i = 0; i < parser.NumData; i++)
                    Parallel.For(0, 30, i =>
                    {
                        var scan         = scans[i];
                        var charge       = charges[i];
                        var protSequence = protSequences[i];
                        var modStr       = modStrs[i];
                        var sequence     = Sequence.CreateSequence(protSequence, modStr, aminoAcidSet);
                        // Assert.True(sequence.Composition.Equals(compositions[i] - Composition.H2O));
                        var ms2Spec = run.GetSpectrum(scan) as ProductSpectrum;

                        if (ms2Spec == null)
                        {
                            Console.WriteLine("Could not get the spectrum datafor scan {0}", scan);
                        }
                        else
                        {
                            Assert.True(ms2Spec != null);
                            var scores = scorer.GetScores(sequence, charge, scan);

                            var deconvSpec = Deconvoluter.GetDeconvolutedSpectrum(ms2Spec, minCharge, maxCharge,
                                                                                  isotopeOffsetTolerance, filteringWindowSize, tolerance, 0.7);

                            var deconvScorer = new CompositeScorerBasedOnDeconvolutedSpectrum(deconvSpec, ms2Spec, tolerance,
                                                                                              comparer);
                            var graph = graphFactory.CreateScoringGraph(deconvScorer, protMass[i]);

                            var gf = new GeneratingFunction(graph);
                            gf.ComputeGeneratingFunction();

                            var specEvalue = gf.GetSpectralEValue(scores.Score);

                            var rowStr    = parser.GetRows()[i];
                            var items     = rowStr.Split('\t').ToArray();
                            var newRowStr = string.Join("\t", items, 0, 15);

                            //writer.WriteLine("{0}\t{1}\t{2}", newRowStr, scores.Score, specEvalue);
                            lines[i] = string.Format("{0}\t{1}\t{2}", newRowStr, scores.Score, specEvalue);
                            //Console.WriteLine("{0}\t{1}\t{2}", items[0], scores.Score, specEvalue);
                        }
                    });

                    foreach (var line in (from item in lines where !string.IsNullOrWhiteSpace(item) select item).Take(20))
                    {
                        Console.WriteLine(line);
                    }
                }
                Console.WriteLine("Done");
            }
        }
Esempio n. 4
0
        public void TestGetScoreDistribution(int scanNum, string protSequence)
        {
            var methodName = MethodBase.GetCurrentMethod().Name;

            Utils.ShowStarting(methodName);

            var pbfFilePath = Utils.GetPbfTestFilePath(false);
            var pbfFile     = Utils.GetTestFile(methodName, pbfFilePath);

            if (!pbfFile.Exists)
            {
                Assert.Ignore(@"Skipping test {0} since file not found: {1}", methodName, pbfFile);
            }

            const string modStr = "";

            const int    maxCharge              = 20;
            const int    minCharge              = 1;
            const double filteringWindowSize    = 1.1;
            const int    isotopeOffsetTolerance = 2;
            var          tolerance              = new Tolerance(10);
            var          run = PbfLcMsRun.GetLcMsRun(pbfFile.FullName);

            // Configure amino acid set
            var oxM      = new SearchModification(Modification.Oxidation, 'M', SequenceLocation.Everywhere, false);
            var dehydroC = new SearchModification(Modification.Dehydro, 'C', SequenceLocation.Everywhere, false);
            var acetylN  = new SearchModification(Modification.Acetylation, '*', SequenceLocation.ProteinNTerm, false);

            const int numMaxModsPerProtein = 4;
            var       searchModifications  = new List <SearchModification>
            {
                dehydroC,
                oxM,
                acetylN
            };
            var aaSet    = new AminoAcidSet(searchModifications, numMaxModsPerProtein);
            var comparer = new FilteredProteinMassBinning(aaSet, 50000, 28);
            //Console.WriteLine("{0}\t{1}", comparer.NumberOfBins, comparer.GetBinNumber(proteinMass));

            var stopwatch    = Stopwatch.StartNew();
            var graphFactory = new ProteinScoringGraphFactory(comparer, aaSet);

            stopwatch.Stop();
            Console.WriteLine(@"edge generation elapsed time = {0:0.000} sec", (stopwatch.ElapsedMilliseconds) / 1000.0d);

            var stopwatch2 = Stopwatch.StartNew();

            var sequence    = Sequence.CreateSequence(protSequence, modStr, aaSet);
            var proteinMass = sequence.Mass + Composition.H2O.Mass;

            Console.WriteLine("Mass = {0}", proteinMass);

            var spectrum   = run.GetSpectrum(scanNum) as ProductSpectrum;
            var deconvSpec = Deconvoluter.GetDeconvolutedSpectrum(spectrum, minCharge, maxCharge,
                                                                  isotopeOffsetTolerance, filteringWindowSize, tolerance, 0.7);

            stopwatch.Restart();

            var scorer = new CompositeScorerBasedOnDeconvolutedSpectrum(deconvSpec, spectrum, tolerance, comparer);
            var graph  = graphFactory.CreateScoringGraph(scorer, proteinMass);

            stopwatch.Stop();
            Console.WriteLine(@"node generation elapsed time = {0:0.000} sec", (stopwatch.ElapsedMilliseconds) / 1000.0d);

            stopwatch.Reset();
            stopwatch.Start();
            var gf = new GeneratingFunction(graph);

            gf.ComputeGeneratingFunction();
            //gf.ComputeGeneratingFunction(graph);
            stopwatch.Stop();
            Console.WriteLine(@"computing generation function = {0:0.000} sec", (stopwatch.ElapsedMilliseconds) / 1000.0d);
            var scoreDist = gf.GetScoreDistribution();

            Console.WriteLine("{0}-{1}", scoreDist.MinScore, scoreDist.MaxScore);

            Console.WriteLine("{0} : {1}", "score", "specEValue");

            for (var score = 15; score <= gf.MaximumScore; score++)
            {
                var specEvalue = gf.GetSpectralEValue(score);
                Console.WriteLine("{0} : {1}", score, specEvalue);
            }

            stopwatch2.Stop();
            Console.WriteLine(@"TOTAL computing generation function = {0:0.000} sec", stopwatch2.ElapsedMilliseconds / 1000.0d);
        }
Esempio n. 5
0
        public void TestGetScoreDistribution()
        {
            var methodName = MethodBase.GetCurrentMethod().Name;

            TestUtils.ShowStarting(methodName);
            const string rawFile      = @"D:\MassSpecFiles\training\raw\QC_Shew_Intact_26Sep14_Bane_C2Column3.pbf";
            const string idFileFolder = @"D:\MassSpecFiles\training\IdScoring\MSPF_trainset";

            const int    scanNum      = 5927;
            const string protSequence = "MNKSELIEKIASGADISKAAAGRALDSFIAAVTEGLKEGDKISLVGFGTFEVRERAERTGRNPQTGEEIKIAAAKIPAFKAGKALKDAVN";

            const string modStr = "";

            var idFile = string.Format(@"{0}\QC_Shew_Intact_26Sep14_Bane_C2Column3_IcTda.tsv", idFileFolder);

            if (!File.Exists(idFile))
            {
                return;
            }
            //Console.WriteLine(dataset);

            if (!File.Exists(rawFile))
            {
                Assert.Ignore(@"Skipping test {0} since file not found: {1}", methodName, rawFile);
            }


            const int    maxCharge              = 20;
            const int    minCharge              = 1;
            const double filteringWindowSize    = 1.1;
            const int    isotopeOffsetTolerance = 2;
            var          tolerance              = new Tolerance(10);
            var          run = PbfLcMsRun.GetLcMsRun(rawFile);

            // Configure amino acid set
            var oxM      = new SearchModification(Modification.Oxidation, 'M', SequenceLocation.Everywhere, false);
            var dehydroC = new SearchModification(Modification.Dehydro, 'C', SequenceLocation.Everywhere, false);
            var acetylN  = new SearchModification(Modification.Acetylation, '*', SequenceLocation.ProteinNTerm, false);

            const int numMaxModsPerProtein = 4;
            var       searchModifications  = new List <SearchModification>
            {
                dehydroC,
                oxM,
                acetylN
            };
            var aaSet    = new AminoAcidSet(searchModifications, numMaxModsPerProtein);
            var comparer = new FilteredProteinMassBinning(aaSet, 50000, 28);
            //Console.WriteLine("{0}\t{1}", comparer.NumberOfBins, comparer.GetBinNumber(proteinMass));

            var stopwatch    = Stopwatch.StartNew();
            var graphFactory = new ProteinScoringGraphFactory(comparer, aaSet);

            stopwatch.Stop();
            Console.WriteLine(@"edge generation elapsed time = {0:0.000} sec", (stopwatch.ElapsedMilliseconds) / 1000.0d);

            var n          = 0;
            var stopwatch2 = Stopwatch.StartNew();

            var sequence    = Sequence.CreateSequence(protSequence, modStr, aaSet);
            var proteinMass = sequence.Mass + Composition.H2O.Mass;

            Console.WriteLine("Mass = {0}", proteinMass);

            var spectrum   = run.GetSpectrum(scanNum) as ProductSpectrum;
            var deconvSpec = Deconvoluter.GetDeconvolutedSpectrum(spectrum, minCharge, maxCharge,
                                                                  isotopeOffsetTolerance, filteringWindowSize, tolerance, 0.7);

            stopwatch.Restart();

            var scorer = new CompositeScorerBasedOnDeconvolutedSpectrum(deconvSpec, spectrum, tolerance, comparer);
            var graph  = graphFactory.CreateScoringGraph(scorer, proteinMass);

            stopwatch.Stop();
            Console.WriteLine(@"node generation elapsed time = {0:0.000} sec", (stopwatch.ElapsedMilliseconds) / 1000.0d);

            stopwatch.Reset();
            stopwatch.Start();
            var gf = new GeneratingFunction(graph);

            gf.ComputeGeneratingFunction();
            //gf.ComputeGeneratingFunction(graph);
            stopwatch.Stop();
            Console.WriteLine(@"computing generation function = {0:0.000} sec", (stopwatch.ElapsedMilliseconds) / 1000.0d);
            var scoreDist = gf.GetScoreDistribution();

            Console.WriteLine("{0}-{1}", scoreDist.MinScore, scoreDist.MaxScore);

            for (var score = 45; score <= gf.MaximumScore; score++)
            {
                var specEvalue = gf.GetSpectralEValue(score);
                Console.WriteLine("{0} : {1}", score, specEvalue);
            }

            stopwatch2.Stop();
            Console.WriteLine(@"TOTAL computing generation function = {0:0.000} sec", (stopwatch2.ElapsedMilliseconds) / 1000.0d);
        }