Exemple #1
0
        public IonFrequencyTable(IEnumerable<IonType> ionTypes, Tolerance tolerance, double relativeIntensityThreshold, bool combineCharges=false)
        {
                        _ionFrequencies = new Dictionary<IonType, Probability<IonType>>();
            _combineCharges = combineCharges;
            _ionTypes = ionTypes.ToArray();
            _tolerance = tolerance;
            _relativeIntensityThreshold = relativeIntensityThreshold;

            var charges = _ionTypes.Select(ionType => ionType.Charge).ToList();
            _ionTypeFactory = new IonTypeFactory(charges.Max());
        }
//        private const string DebugFileName = @"C:\Users\wilk011\Documents\DataFiles\TestFolder\debug_HCD_QCShew_Precursor.txt";
        private IEnumerable<SpectrumMatch> InitTest()
        {
            var ionTypeFactory = new IonTypeFactory(_baseIons, _neutralLosses, MaxCharge);

            _ionTypes = ionTypeFactory.GetAllKnownIonTypes().ToList();

            var lcms = new LazyLcMsRun(RawFile, NoiseFiltration, NoiseFiltration);

            var spectrumMatches = (new SpectrumMatchList(lcms, TsvFile, DataFileFormat.IcBottomUp));

            return spectrumMatches;
        }
Exemple #3
0
        public PrecursorFilter(PrecursorOffsets offsets, Tolerance tolerance)
        {
            _offsets = offsets;
            _tolerance = tolerance;

            var maxCharge = offsets.Charge;

            BaseIonType[] baseIons = { BaseIonType.Y };
            NeutralLoss[] neutralLosses = { NeutralLoss.NoLoss };

            var ionTypeFactory = new IonTypeFactory(baseIons, neutralLosses, maxCharge);

            _precursorIonTypes = ionTypeFactory.GetAllKnownIonTypes().ToList();
        }
        public PrecursorOffsetFrequencyTable(double searchWidth, int charge = 1, double binWidth = 1.005)
        {
            _offsetCounts = new Histogram<double>();
            _searchWidth = searchWidth;
            _binWidth = binWidth;
            Charge = charge;
            Total = 0;
            GenerateEdges();
            BaseIonType[] baseIons = { BaseIonType.Y };
            NeutralLoss[] neutralLosses = { NeutralLoss.NoLoss };

            var ionTypeFactory = new IonTypeFactory(baseIons, neutralLosses, charge);

            _precursorIonTypes = ionTypeFactory.GetAllKnownIonTypes().ToList();
        }
Exemple #5
0
        // Read Configuration file
        private void InitTest(ConfigFileReader reader)
        {
            // Read program variables
            var config = reader.GetNodes("vars").First();
            _precursorCharge = Convert.ToInt32(config.Contents["precursorcharge"]);
            var actStr = config.Contents["activationmethod"].ToLower();

            _combineCharges = (config.Contents.ContainsKey("combinecharges") &&
                 config.Contents["combinecharges"].ToLower() == "true");

            _useDecoy = (config.Contents.ContainsKey("usedecoy") &&
                config.Contents["usedecoy"].ToLower() == "true");

            _relativeIntensityThreshold = Convert.ToDouble(config.Contents["relativeintensitythreshold"]);

            // Read ion data
            var ionInfo = reader.GetNodes("ion").First();
            int totalCharges = Convert.ToInt32(ionInfo.Contents["totalcharges"]);
            var ionTypeStr = ionInfo.Contents["iontype"].Split(',');
            var ions = new BaseIonType[ionTypeStr.Length];
            for (int i = 0; i < ionTypeStr.Length; i++)
            {
                switch (ionTypeStr[i].ToLower())
                {
                    case "a":
                        ions[i] = BaseIonType.A;
                        break;
                    case "b":
                        ions[i] = BaseIonType.B;
                        break;
                    case "c":
                        ions[i] = BaseIonType.C;
                        break;
                    case "x":
                        ions[i] = BaseIonType.X;
                        break;
                    case "y":
                        ions[i] = BaseIonType.Y;
                        break;
                    case "z":
                        ions[i] = BaseIonType.Z;
                        break;
                }
            }
            var ionLossStr = ionInfo.Contents["losses"].Split(',');
            var ionLosses = new NeutralLoss[ionLossStr.Length];
            for (int i = 0; i < ionLossStr.Length; i++)
            {
                switch (ionLossStr[i].ToLower())
                {
                    case "noloss":
                        ionLosses[i] = NeutralLoss.NoLoss;
                        break;
                    case "nh3":
                        ionLosses[i] = NeutralLoss.NH3;
                        break;
                    case "h2o":
                        ionLosses[i] = NeutralLoss.H2O;
                        break;
                }
            }
            _ionTypeFactory = new IonTypeFactory(ions, ionLosses, totalCharges);
            _ionTypes = _ionTypeFactory.GetAllKnownIonTypes().ToList();
            var tempIonList = new List<IonType>();
            if (ionInfo.Contents.ContainsKey("exclusions"))
            {
                var ionExclusions = ionInfo.Contents["exclusions"].Split(',');
                tempIonList.AddRange(_ionTypes.Where(ionType => !ionExclusions.Contains(ionType.Name)));
                _ionTypes = tempIonList;
            }

            // Read input and output file names
            var fileInfo = reader.GetNodes("fileinfo").First();
            _names = fileInfo.Contents["name"].Split(',');
            _preTsv = fileInfo.Contents["tsvpath"];
            _preRaw = fileInfo.Contents["rawpath"];
            var outPathtemp = fileInfo.Contents["outpath"];
            _outPre = outPathtemp;
            var outFiletemp = fileInfo.Contents["outfile"];
            _outFileName = _outPre + outFiletemp;
        }
Exemple #6
0
        /// <summary>
        /// Get a <see cref="IonTypeFactory"/> for the deconvoluted versions of <paramref name="baseIons"/> and <paramref name="neutralLosses"/>
        /// </summary>
        /// <param name="baseIons"></param>
        /// <param name="neutralLosses"></param>
        /// <returns></returns>
        public static IonTypeFactory GetDeconvolutedIonTypeFactory(IEnumerable <BaseIonType> baseIons, IEnumerable <NeutralLoss> neutralLosses)
        {
            var ionTypeFactory = new IonTypeFactory(baseIons.Select(ion => ion.GetDeconvolutedIon()), neutralLosses, 1);

            return(ionTypeFactory);
        }
Exemple #7
0
        public void TestFitScoreCalculationEtd()
        {
            var methodName = MethodBase.GetCurrentMethod().Name;
            TestUtils.ShowStarting(methodName);

            if (!File.Exists(TestLcMsRun.TestTopDownRawFilePathEtd))
            {
                Assert.Ignore(@"Skipping test " + methodName + @" since file not found: " + TestLcMsRun.TestTopDownRawFilePathCid);
            }

            var run = InMemoryLcMsRun.GetLcMsRunScanRange(TestLcMsRun.TestTopDownRawFilePathEtd, 810, 810);
            var spec = run.GetSpectrum(810) as ProductSpectrum;
            Assert.True(spec != null);

            const string suf54 = "ENIKTLPAKRNEQDQKQLIVPLADSLKPGTYTVDWHVVSVDGHKTKGHYTFSVK";
            var suf54Comp = new AminoAcidSet().GetComposition(suf54);
            Assert.True(suf54Comp != null);

            var ionType = new IonTypeFactory(10).GetIonType("z6");
            var ion = ionType.GetIon(suf54Comp);
            //ion.Composition.ComputeApproximateIsotopomerEnvelop();
            Console.WriteLine("MonoMz: {0}, MonoMass: {1}", ion.GetMonoIsotopicMz(), ion.Composition.Mass);

            var fitScore = spec.GetFitScore(ion, new Tolerance(15), 0.1);
            Console.WriteLine("FitScore: {0}", fitScore);
            Assert.True(fitScore < 0.15);
        }
        public void ReadConfigurationFile(string configurationFile)
        {
            var reader = new ConfigFileReader(configurationFile);
            // Read program variables
            var config = reader.GetNodes("vars").First();
            PrecursorCharge = Convert.ToInt32(config.Contents["precursorcharge"]);
            PrecursorOffsetThreshold = Convert.ToDouble(config.Contents["precursoroffsetthreshold"]);
            WindowWidth = Convert.ToInt32(config.Contents["searchwidth"]);
            PrecursorOffsetWidth = Convert.ToInt32(config.Contents["precursoroffsetwidth"]);
            RetentionCount = Convert.ToInt32(config.Contents["retentioncount"]);
            RelativeIntensityThreshold = Convert.ToDouble(config.Contents["relativeintensitythreshold"]);
            SelectedIonThreshold = Convert.ToDouble(config.Contents["selectedionthreshold"]);
            MassBinSize = Convert.ToInt32(config.Contents["massbinsize"]);
            var actStr = config.Contents["activationmethod"].ToLower();
            switch (actStr)
            {
                case "hcd":
                    ActivationMethod = ActivationMethod.HCD;
                    Tolerance = _defaultTolerancePpm;
                    break;
                case "cid":
                    ActivationMethod = ActivationMethod.CID;
                    Tolerance = _defaultToleranceTh;
                    break;
                case "etd":
                    ActivationMethod = ActivationMethod.ETD;
                    Tolerance = _defaultTolerancePpm;
                    break;
                default:
                    throw new FormatException("Invalid Activation Method.");
            }

            var acqStr = config.Contents["acquisitionmethod"].ToLower();
            switch (acqStr)
            {
                case "dia":
                    AcquisitionMethod = AcquisitionMethod.Dia;
                    break;
                case "dda":
                    AcquisitionMethod = AcquisitionMethod.Dda;
                    break;
                default:
                    throw new FormatException("Invalid Acquisition Method.");
            }

            MassErrorTolerance = _defaultToleranceTh;

            MaxRanks = Convert.ToInt32(config.Contents["maxranks"]);

            var smoothingRanksStr = config.Contents["smoothingranks"].Split(',');
            SmoothingRanks = new int[smoothingRanksStr.Length];
            var smoothingWindowSizeStr = config.Contents["smoothingwindowsize"].Split(',');
            SmoothingWindowSize = new int[smoothingWindowSizeStr.Length];
            if (SmoothingRanks.Length != SmoothingWindowSize.Length)
                throw new ArgumentException("SmoothingRanks and SmoothingWindowSize unequal lengths.");
            for (int i = 0; i < SmoothingRanks.Length; i++)
            {
                if (smoothingRanksStr[i] == "Max") SmoothingRanks[i] = Int32.MaxValue;
                else SmoothingRanks[i] = Convert.ToInt32(smoothingRanksStr[i]);
                SmoothingWindowSize[i] = Convert.ToInt32(smoothingWindowSizeStr[i]);
            }

            // Read ion data
            var ionInfo = reader.GetNodes("ion").First();
            int totalCharges = Convert.ToInt32(ionInfo.Contents["totalcharges"]);
            var ionTypeStr = ionInfo.Contents["iontype"].Split(',');
            var ions = new BaseIonType[ionTypeStr.Length];
            for (int i = 0; i < ionTypeStr.Length; i++)
            {
                switch (ionTypeStr[i].ToLower())
                {
                    case "a":
                        ions[i] = BaseIonType.A;
                        break;
                    case "b":
                        ions[i] = BaseIonType.B;
                        break;
                    case "c":
                        ions[i] = BaseIonType.C;
                        break;
                    case "x":
                        ions[i] = BaseIonType.X;
                        break;
                    case "y":
                        ions[i] = BaseIonType.Y;
                        break;
                    case "z":
                        ions[i] = BaseIonType.Z;
                        break;
                }
            }
            var ionLossStr = ionInfo.Contents["losses"].Split(',');
            var ionLosses = new NeutralLoss[ionLossStr.Length];
            for (int i = 0; i < ionLossStr.Length; i++)
            {
                switch (ionLossStr[i].ToLower())
                {
                    case "noloss":
                        ionLosses[i] = NeutralLoss.NoLoss;
                        break;
                    case "nh3":
                        ionLosses[i] = NeutralLoss.NH3;
                        break;
                    case "h2o":
                        ionLosses[i] = NeutralLoss.H2O;
                        break;
                }
            }
            _ionTypeFactory = new IonTypeFactory(ions, ionLosses, totalCharges);
            IonTypes = _ionTypeFactory.GetAllKnownIonTypes().ToArray();
            var tempIonList = new List<IonType>();
            if (ionInfo.Contents.ContainsKey("exclusions"))
            {
                var ionExclusions = ionInfo.Contents["exclusions"].Split(',');
                tempIonList.AddRange(IonTypes.Where(ionType => !ionExclusions.Contains(ionType.Name)));
                IonTypes = tempIonList.ToArray();
            }

            // Read input and output file names
            var fileInfo = reader.GetNodes("fileinfo").First();
            DataSets = fileInfo.Contents["name"].Split(',');
            var dataFormat = fileInfo.Contents["format"];
            switch (dataFormat)
            {
                case "mgf":
                    DataFormat = DataFileFormat.Mgf;
                    break;
                case "icbottomup":
                    DataFormat = DataFileFormat.IcBottomUp;
                    break;
                case "dia":
                    DataFormat = DataFileFormat.Dia;
                    break;
                default:
                    throw new FormatException("Invalid Acquisition Method.");
            }

            TsvPath = fileInfo.Contents["tsvpath"];
            DataPath = fileInfo.Contents["datapath"];
            var outPathtemp = fileInfo.Contents["outpath"];
            OutputPath = outPathtemp;

            OutputFileName = OutputPath + fileInfo.Contents["outputfile"];
        }
Exemple #9
0
 private void ReadFromFile(StreamReader file, IonTypeFactory ionTypeFactory)
 {
     var line = file.ReadLine();
     while (line != null)
     {
         var parts = line.Split('\t').ToList();
         var header = parts[0];
         parts.RemoveAt(0);
         if (header == "MaxRanks")   MaxRanks = Convert.ToInt32(parts[0]);
         else if (header == "Total")
         {
             if (MaxRanks < 0) throw new FormatException("Badly formatted rank data.");
             _rankTotals = new double[MaxRanks+1];
             for (int i = 0; i < MaxRanks+1; i++)
             {
                 _rankTotals[i] = Convert.ToInt32(parts[i]);
             }
             // reached end of rank table entry
             break;
         }
         else if (header == "Unexplained") {}
         else
         {
             if (MaxRanks < 0) throw new FormatException("Badly formatted rank data.");
             try
             {
                 var ionType = ionTypeFactory.GetIonType(header);
                 _rankTable.Add(ionType, new double[MaxRanks+1]);
                 for (int i = 0; i < MaxRanks+1; i++)
                 {
                     _rankTable[ionType][i] = Convert.ToDouble(parts[i]);
                 }
             }
             catch (KeyNotFoundException)
             {
                 throw new FormatException("Invalid ion type: " + header);
             }
         }
         line = file.ReadLine();
     }
 }
Exemple #10
0
 /// <summary>
 /// RankTable constructor for creating RankTable from taining parameter file.
 /// </summary>
 /// <param name="file">Training data file past position of RankProbabilities label.</param>
 /// <param name="ionTypeFactory">IonTypeFactory object with all known possible ions in training
 /// parameter file.</param>
 public RankTable(StreamReader file, IonTypeFactory ionTypeFactory)
 {
     MaxRanks = -1;
     _rankTable = new Dictionary<IonType, double[]>();
     ReadFromFile(file, ionTypeFactory);
 }
Exemple #11
0
        private void ReadFromFile(string paramFile, Boolean verbose)
        {
            if (!File.Exists(paramFile))
                return;

            var allIonTypes = new IonTypeFactory();

            using (var reader = new JavaBinaryReader(File.Open(paramFile, FileMode.Open)))
            {
                // Version
                var version = reader.ReadInt32();
                if(verbose) Console.WriteLine("Version: {0}", version);

                // Activation method
                var actMethod = new string(reader.ReadChars(reader.ReadByte()));

                // Instrument type
                var instType = new string(reader.ReadChars(reader.ReadByte()));

                // Enzyme
                var enzyme = new string(reader.ReadChars(reader.ReadByte()));

                // Protocol
                var len = reader.ReadByte();
                var protocol = new string(reader.ReadChars(len));

                if (verbose) Console.WriteLine("Spectral type: {0}_{1}_{2}{3}", actMethod, instType, enzyme, protocol.Length > 0 ? "_"+protocol : "");

                // TODO: set up spectral type

                // Tolerance
                var isTolerancePpm = reader.ReadBoolean();
                var mmeVal = reader.ReadSingle();
                // Ignore mme
                //_mme = new Tolerance(mmeVal, isTolerancePpm ? ToleranceUnit.Ppm : ToleranceUnit.Da);

                // Deconvolution information
                _applyDeconvolution = reader.ReadBoolean();
                _deconvolutionErrorToleranceDa = reader.ReadSingle();
                if (verbose) Console.WriteLine("Apply deconvolution: {0}, Tolerance: {1}", _applyDeconvolution, _deconvolutionErrorToleranceDa);

                // Charge histogram
                if (verbose) Console.WriteLine("Charge Histogram");
                var chargeHistSize = reader.ReadInt32();
                _chargeHistogram = new Dictionary<int, int>();
                for (var i = 0; i < chargeHistSize; i++)
                {
                    var charge = reader.ReadInt32();
                    var numSpecs = reader.ReadInt32();
                    _chargeHistogram[charge] = numSpecs;
                    if (verbose) Console.WriteLine(charge + "\t" + numSpecs);
                }

                // Partition information
                var numPartitions = reader.ReadInt32();
                if (verbose) Console.WriteLine("Partition Information\t" + numPartitions);
                _numSegments = reader.ReadInt32();
                _partitionSet = new SortedSet<Partition>();

                for (var i = 0; i < numPartitions; i++)
                {
                    var charge = reader.ReadInt32();
                    var neutralPeptideMass = reader.ReadSingle();
                    var segIndex = reader.ReadInt32();
                    _partitionSet.Add(new Partition(charge, neutralPeptideMass, segIndex));
                    if (verbose) Console.WriteLine("{0}\t{1}\t{2}", charge, neutralPeptideMass, segIndex);
                }

                // Precursor offset frequency function
                if (verbose) Console.WriteLine("Precursor Offset Frequency Function");
                _precursorOffMap = new Dictionary<int, IList<PrecursorOffsetFrequency>>();
                _numPrecursorOffsets = reader.ReadInt32();
                for (var i = 0; i < _numPrecursorOffsets; i++)
                {
                    var charge = reader.ReadInt32();
                    var reducedCharge = reader.ReadInt32();
                    var offset = reader.ReadSingle();
                    var isTolPpm = reader.ReadBoolean();
                    var tolVal = reader.ReadSingle();
                    var tolerance = new Tolerance(tolVal, isTolPpm ? ToleranceUnit.Ppm : ToleranceUnit.Da);
                    var frequency = reader.ReadSingle();

                    IList<PrecursorOffsetFrequency> offList;
                    if (!_precursorOffMap.TryGetValue(charge, out offList))
                    {
                        offList = new List<PrecursorOffsetFrequency>();
                        _precursorOffMap[charge] = offList;
                    }
                    offList.Add(new PrecursorOffsetFrequency(reducedCharge, offset, frequency, tolerance));
                    if (verbose) Console.WriteLine("{0}\t{1}\t{2}\t{3}\t{4}",
                        charge, reducedCharge, offset, tolerance, frequency);
                }

                // Fragment ion offset frequency function
                if (verbose) Console.WriteLine("Fragment Offset Frequency Function");
                _fragmentOffMap = new Dictionary<Partition, IEnumerable<FragmentOffsetFrequency>>();
                foreach (var partition in _partitionSet)
                {
                    var numIons = reader.ReadInt32();
                    if (verbose) Console.WriteLine("Partition {0}\t{1}\t{2}\t{3}", partition.Charge, partition.SegmentIndex, partition.NeutralPeptideMass, numIons);
                    var fragmentOff = new FragmentOffsetFrequency[numIons];
                    for (var ionIndex = 0; ionIndex < numIons; ionIndex++)
                    {
                        var isPrefix = reader.ReadBoolean();
                        var charge = reader.ReadInt32();
                        var offset = reader.ReadSingle();
                        var frequency = reader.ReadSingle();
                        fragmentOff[ionIndex] = new FragmentOffsetFrequency(allIonTypes.GetIonType(isPrefix, charge, offset), frequency);
                        if(verbose) Console.WriteLine("{0}_{1}_{2}\t{3}\t{4}", isPrefix ? "P" : "S", charge, Math.Round(offset), frequency, offset);
                    }
                    _fragmentOffMap.Add(partition, fragmentOff);
                }

                //// TODO: determine fragment ions to be used for scoring

                //// Rank distributions
                //var maxRank = reader.ReadInt32();
                //_rankDistTable = new Dictionary<Partition, Dictionary<IonType, float[]>>();
                //for (var i = 0; i < numPartitions; i++)
                //{
                //    // repeat this for #Ions
                //    for (var rank = 0; rank < maxRank + 1; rank++)
                //    {
                //        var frequency = reader.ReadSingle();
                //    }
                //}

                //// Error distributions
                //var errorScalingFactor = reader.ReadInt32();
                //if (errorScalingFactor > 0)
                //{
                //    var numErrorBins = errorScalingFactor*2 + 1;

                //    // Ion error distribution
                //    for (var i = 0; i < numErrorBins; i++)
                //    {
                //        var ionErrorDist = reader.ReadSingle();
                //    }

                //    // Noise error distribution
                //    for (var i = 0; i < numErrorBins; i++)
                //    {
                //        var noiseErrorDist = reader.ReadSingle();
                //    }

                //    // Ion existence table
                //    for (var i = 0; i < 4; i++)
                //    {
                //        var ionExFreq = reader.ReadSingle();
                //    }
                //}

                //// Validation
                //var validationCode = reader.ReadInt32();
                //if (validationCode != Int32.MaxValue)
                //{
                //    Console.WriteLine("Error while reading parameter file {0}", paramFile);
                //    System.Environment.Exit(-1); // Error
                //}
            }
        }
Exemple #12
0
 public static IonTypeFactory GetDeconvolutedIonTypeFactory(IEnumerable<BaseIonType> baseIons, IEnumerable<NeutralLoss> neutralLosses)
 {
     var ionTypeFactory = new IonTypeFactory(baseIons.Select(ion => ion.GetDeconvolutedIon()), neutralLosses, 1);
     return ionTypeFactory;
 }
Exemple #13
0
 private void Read(StreamReader file)
 {
     var ionTypeFactory = new IonTypeFactory(2);
     var massBins = new List<double>();
     var binEdges = new List<double>();
     var charge = 0;
     var line = file.ReadLine();
     while (line != null)
     {
         var parts = line.Split('\t').ToList();
         var header = parts[0];
         parts.RemoveAt(0);
         if (header == "BinSize") massBins.AddRange(parts.Select(Convert.ToDouble));
         else if (header == "BinEdges")
         {
             binEdges.Add(Convert.ToDouble(parts[0]));
         }
         else if (header == "Charge")
         {
             if (binEdges.Count > 0)
             {
                 _massSorter[charge].BinEdges = binEdges.ToArray();
                 binEdges.Clear();
             }
             charge = Convert.ToInt32(parts[0]);
             if (!_charges.Contains(charge))
             {
                 _charges.Add(charge);
                 _massSorter.Add(charge, new Histogram<double>());
                 _rankTables.Add(charge, new List<RankTable>());
                 _drankTables.Add(charge, new List<RankTable>());
                 _ionProbabilities.Add(charge, new List<IonFrequencyTable>());
                 _massErrors.Add(charge, new List<MassErrorTable>());
             }
         }
         else if (header == "RankProbabilities")
         {
             if (massBins.Count == 0 || charge == 0) throw new FormatException("Badly formatted training file.");
             _rankTables[charge].Add(new RankTable(file, ionTypeFactory));
             _drankTables[charge].Add(new RankTable(file, ionTypeFactory));
         }
         line = file.ReadLine();
     }
     _massSorter[charge].BinEdges = binEdges.ToArray();
 }
Exemple #14
0
        public void TestPpmErrorCalculation(string seqText, string rawFilePath, int scanNum)
        {
            var methodName = MethodBase.GetCurrentMethod().Name;
            ShowStarting(methodName, rawFilePath);

            var tolerance = new Tolerance(10, ToleranceUnit.Ppm);
            const int maxCharge = 15;
            const double relIntThres = 0.1;

            if (!File.Exists(rawFilePath))
            {
                Assert.Ignore(@"Skipping test {0} since file not found: {1}", methodName, rawFilePath);
            }

            // init
            var sequence = Sequence.GetSequenceFromMsGfPlusPeptideStr(seqText);
            var lcms = PbfLcMsRun.GetLcMsRun(rawFilePath);
            var spectrum = lcms.GetSpectrum(scanNum);

            var ionTypeFactory = new IonTypeFactory(maxCharge);
            var iontypes = ionTypeFactory.GetAllKnownIonTypes();

            foreach (var iontype in iontypes)
            {
                var ion = iontype.GetIon(sequence.Composition);
                var obsPeaks = spectrum.GetAllIsotopePeaks(ion, tolerance, relIntThres);
                if (obsPeaks == null) continue;
                var isotopes = ion.GetIsotopes(relIntThres).ToArray();
                for (int i = 0; i < isotopes.Length; i++)
                {
                    if (obsPeaks[i] == null) continue;
                    var obsMz = obsPeaks[i].Mz;
                    var theoMz = ion.GetIsotopeMz(isotopes[i].Index);
                    var ppmError = (obsMz - theoMz)/theoMz*1e6;
                    Assert.True(ppmError <= tolerance.GetValue());
                }
            }
        }
Exemple #15
0
        public void TestIonTypeFactory()
        {
            var methodName = MethodBase.GetCurrentMethod().Name;
            ShowStarting(methodName);

            const string sequenceStr = "PEPTIDE";
            var aminoAcidSet = new AminoAcidSet();
            var sequence = new Sequence(sequenceStr, aminoAcidSet);
            var compositionOfFirstPrefix = sequence.GetComposition(0, 2);
            Console.WriteLine("{0}\t{1}", compositionOfFirstPrefix, compositionOfFirstPrefix.Mass);

            var ionTypeFactory = new IonTypeFactory(new[] { BaseIonType.B, BaseIonType.Y }, new[] { NeutralLoss.NoLoss }, 10);
            var bIon = ionTypeFactory.GetIonType("b");
            var yIon = ionTypeFactory.GetIonType("y2");
            Console.WriteLine("{0}\t{1}\t{2}", bIon, bIon.OffsetComposition, bIon.OffsetComposition.Mass);
            Console.WriteLine("{0}\t{1}\t{2}", yIon, yIon.OffsetComposition, yIon.OffsetComposition.Mass);

            // Compute mass of y2 = AveragineMass(DE) + OffsetY
            var compositionOfSecondSuffix = sequence.GetComposition(sequenceStr.Length - 2, sequenceStr.Length);
            var y2Ion = yIon.GetIon(compositionOfSecondSuffix);
            Console.WriteLine("m/z of y++: {0}", y2Ion.GetMonoIsotopicMz());
        }
Exemple #16
0
        public void TestIonTypeGeneration()
        {
            var methodName = MethodBase.GetCurrentMethod().Name;
            ShowStarting(methodName);

            var ionTypeFactory = new IonTypeFactory();
            int index = 0;
            foreach (var ionType in ionTypeFactory.GetAllKnownIonTypes())
            {
                Console.WriteLine(++index + ": " + ionType);
            }
            var yIon = ionTypeFactory.GetIonType("y2-H2O");
            Console.WriteLine(yIon.GetMz(0));
        }
Exemple #17
0
        public void TestGetProductIons()
        {
            var methodName = MethodBase.GetCurrentMethod().Name;
            ShowStarting(methodName);

            var aaSet = new AminoAcidSet(Modification.Carbamidomethylation);
            var sequence = new Sequence("CCAADDKEACFAVEGPK", aaSet);

            var ionTypeFactory = new IonTypeFactory(
                new[] {BaseIonType.B, BaseIonType.Y}, 
                new[] {NeutralLoss.NoLoss, NeutralLoss.H2O}, 
                maxCharge: 2);

            Console.WriteLine("Precursor Ion: {0}\t{1}", sequence.GetPrecursorIon(2).Composition, sequence.GetPrecursorIon(2).GetMonoIsotopicMz());
            Console.WriteLine("Product ions: ");
            var productIons = sequence.GetProductIons(ionTypeFactory.GetAllKnownIonTypes());
            foreach (var theoIon in productIons)
            {
                var ionTypeAndIndex = theoIon.Key;
                var ionType = ionTypeAndIndex.Item1;
                var index = ionTypeAndIndex.Item2;
                var ion = theoIon.Value;
                Console.WriteLine("{0}\t{1}\t{2}\t{3}\t{4}", ionType.Name, index, ion.Composition, ion.Charge, ion.GetMonoIsotopicMz());
            }
        }