Beispiel #1
0
        public void TestFeatureAlignment()
        {
            const string outFilePath = @"\\protoapps\UserData\Jungkap\Lewy\aligned\promex_crosstab_temp.tsv";


            //CPTAC_Intact_CR32A_24Aug15_Bane_15-02-06-RZ
            var prsmReader = new ProteinSpectrumMatchReader();
            var tolerance  = new Tolerance(10);
            var alignment  = new LcMsFeatureAlignment(new AnalysisCompRef.CompRefFeatureComparer(tolerance));

            for (var i = 0; i < NdataSet; i++)
            {
                var rawFile   = string.Format(@"{0}\{1}.pbf", PbfPath, GetDataSetNames(i));
                var mspFile   = string.Format(@"{0}\{1}_IcTda.tsv", MsPfFolder, GetDataSetNames(i));
                var mspFile2  = string.Format(@"{0}\{1}_IcTda.tsv", MsPfFolder2, GetDataSetNames(i));
                var ms1FtFile = string.Format(@"{0}\{1}.ms1ft", Ms1FtFolder, GetDataSetNames(i));
                Console.WriteLine(rawFile);
                var run       = PbfLcMsRun.GetLcMsRun(rawFile);
                var prsmList1 = prsmReader.LoadIdentificationResult(mspFile, ProteinSpectrumMatch.SearchTool.MsPathFinder);
                var prsmList2 = prsmReader.LoadIdentificationResult(mspFile2, ProteinSpectrumMatch.SearchTool.MsPathFinder);
                prsmList1.AddRange(prsmList2);

                var prsmList = MergePrsm(prsmList1);
                var features = LcMsFeatureAlignment.LoadProMexResult(i, ms1FtFile, run);

                for (var j = 0; j < prsmList.Count; j++)
                {
                    var match = prsmList[j];
                    match.ProteinId = match.ProteinName;
                }

                // tag features by PrSMs
                for (var j = 0; j < features.Count; j++)
                {
                    //features[j].ProteinSpectrumMatches = new ProteinSpectrumMatchSet(i);
                    var massTol = tolerance.GetToleranceAsTh(features[j].Mass);
                    foreach (var match in prsmList)
                    {
                        if (features[j].MinScanNum < match.ScanNum && match.ScanNum < features[j].MaxScanNum && Math.Abs(features[j].Mass - match.Mass) < massTol)
                        {
                            features[j].ProteinSpectrumMatches.Add(match);
                        }
                    }
                }

                alignment.AddDataSet(i, features, run);
            }

            alignment.AlignFeatures();

            Console.WriteLine("{0} alignments ", alignment.CountAlignedFeatures);

            for (var i = 0; i < NdataSet; i++)
            {
                alignment.FillMissingFeatures(i);
                Console.WriteLine("{0} has been processed", GetDataSetNames(i));
            }

            OutputCrossTabWithId(outFilePath, alignment);
        }
Beispiel #2
0
        public void TestMaxEntDeconvoluter()
        {
            const string rawFileFolder = @"\\proto-11\MSXML_Cache\PBF_Gen_1_214\2015_4";
            const string fname         = "WHIM2_LoHi_T2DD_HCD_GF07_02";
            var          rawFile       = string.Format(@"{0}\{1}.pbf", rawFileFolder, fname);
            var          ms1ft         = string.Format(@"\\protoapps\UserData\Jungkap\CompRef\lowRes\{0}.ms1ft", fname);

            var run         = PbfLcMsRun.GetLcMsRun(rawFile, 1.4826, 0);
            var ms1ScanNums = run.GetMs1ScanVector();

            var featureFinder = new LcMsPeakMatrixLowResolution(run);

            foreach (var scan in ms1ScanNums)
            {
                var fts = featureFinder.DetectMs1Features(scan);
                //Console.WriteLine("{0}\t{1}",scan, fts.Count);
            }

            var features = featureFinder.GetLcMsFeatures();

            var writer = new StreamWriter(ms1ft);
            var id     = 1;

            writer.WriteLine("FeatureID\tMinScan\tMaxScan\tMinCharge\tMaxCharge\tMonoMass\tAbundance\tRepScan\tMaxElutionTime\tElutionLength\tLikelihoodRatio");
            foreach (var feature in features.OrderBy(f => f.Mass))
            {
                writer.WriteLine("{0}\t{1}\t{2}\t{3}\t{4}\t{5}\t{6}\t{7}\t{8}\t{9}\t{10}", id, feature.MinScanNum, feature.MaxScanNum, feature.MinCharge,
                                 feature.MaxCharge, feature.Mass, feature.Abundance, feature.RepresentativeScanNum, feature.MinElutionTime, feature.MaxElutionTime, 0);
                id++;
            }
            writer.Close();
        }
Beispiel #3
0
        public void TestSumMs2Spectra()
        {
            var methodName = MethodBase.GetCurrentMethod().Name;

            Utils.ShowStarting(methodName);

            var specFilePath = Path.Combine(Utils.DEFAULT_TEST_FILE_FOLDER, @"TestYufengData\NewQC_LongSep_29Sep14_141001104925.raw");

            if (!File.Exists(specFilePath))
            {
                Assert.Ignore(@"Skipping test " + methodName + @" since file not found: " + specFilePath);
            }

            const int minScanNum = 1289;
            //const int maxScanNum = 1389;
            const int minCharge = 6;
            //const int maxCharge = 6;
            const string sequence = "EIRGYRPPEPYKGKGVRYDDEEVRRKEAKKK";
            var          aaSet    = new AminoAcidSet();

            var run = PbfLcMsRun.GetLcMsRun(specFilePath);

            var scorer = new InformedTopDownScorer(run, aaSet, 1, minCharge - 1, new Tolerance(10));

            scorer.GetScores(AminoAcid.ProteinNTerm, sequence, AminoAcid.ProteinCTerm,
                             Composition.Parse("C(166) H(270) N(52) O(49) S(0)"), minCharge, minScanNum);
        }
Beispiel #4
0
        public void TestIsosFilter()
        {
            var methodName = MethodBase.GetCurrentMethod().Name;

            TestUtils.ShowStarting(methodName);

            const string isosFilePath = @"H:\Research\QCShew_TopDown\Production\ICRTools\QC_Shew_Intact_26Sep14_Bane_C2Column3_Isos.csv";

            if (!File.Exists(isosFilePath))
            {
                Assert.Ignore(@"Skipping test {0} since file not found: {1}", methodName, isosFilePath);
            }

            const string rawFilePath = @"H:\Research\QCShew_TopDown\Production\QC_Shew_Intact_26Sep14_Bane_C2Column3.raw";

            if (!File.Exists(rawFilePath))
            {
                Assert.Ignore(@"Skipping test {0} since file not found: {1}", methodName, rawFilePath);
            }

            var run    = PbfLcMsRun.GetLcMsRun(rawFilePath);
            var filter = new IsosFilter(run, new Tolerance(10), isosFilePath);

            Console.WriteLine(string.Join("\t", filter.GetMatchingMs2ScanNums(30261.68374)));
        }
Beispiel #5
0
        public void TestAbpSumMs1Spectra()
        {
            var methodName = MethodBase.GetCurrentMethod().Name;

            Utils.ShowStarting(methodName);

            var specFilePath = Path.Combine(Utils.DEFAULT_TEST_FILE_FOLDER, @"TestYufengData\QC_ShewIntact_2ug_3k_CID_4Apr14_Bane_PL011402.raw");

            if (!File.Exists(specFilePath))
            {
                Assert.Ignore(@"Skipping test " + methodName + @" since file not found: " + specFilePath);
            }

            const int minScanNum = 5657;
            const int maxScanNum = 5699;
            const int MAX_POINTS = 50;

            var run = PbfLcMsRun.GetLcMsRun(specFilePath);

            if (run == null)
            {
                return;
            }
            var summedSpec       = run.GetSummedMs1Spectrum(minScanNum, maxScanNum);
            var peakList         = summedSpec.GetPeakListWithin(1180.0, 1192.0);
            var filteredPeakList = new List <Peak>();

            PeakListUtils.FilterNoise(peakList, ref filteredPeakList);
            new Spectrum(filteredPeakList, 0).Display(MAX_POINTS);
        }
Beispiel #6
0
        public void TestSumMs1Spectra()
        {
            var methodName = MethodBase.GetCurrentMethod().Name;

            Utils.ShowStarting(methodName);

            if (!File.Exists(TestRawFilePath))
            {
                Assert.Ignore(@"Skipping test " + methodName + @" since file not found: " + TestRawFilePath);
            }

            const int minScanNum = 46454;
            const int maxScanNum = 46661;
            const int MAX_POINTS = 50;

            var run = PbfLcMsRun.GetLcMsRun(TestRawFilePath) as PbfLcMsRun;

            if (run == null)
            {
                return;
            }
            var summedSpec = run.GetSummedMs1Spectrum(minScanNum, maxScanNum);

            summedSpec.Display(MAX_POINTS);
        }
Beispiel #7
0
        public void TestRunningTimeSummingSpectra()
        {
            var methodName = MethodBase.GetCurrentMethod().Name;

            Utils.ShowStarting(methodName);

            if (!File.Exists(TestRawFilePath))
            {
                Assert.Ignore(@"Skipping test " + methodName + @" since file not found: " + TestRawFilePath);
            }

            var run = PbfLcMsRun.GetLcMsRun(TestRawFilePath, 1.4826, 1.4826) as PbfLcMsRun;

            var sw = new Stopwatch();

            sw.Start();

            const int windowSize = 5;

            foreach (var scanNum in run.GetScanNumbers(1))
            {
                //var spec = run.GetSpectrum(scanNum);
                var spec = run.GetSummedMs1Spectrum(Math.Max(scanNum - windowSize, run.MinLcScan),
                                                    Math.Min(scanNum + windowSize, run.MaxLcScan));
            }
            sw.Stop();

            Console.WriteLine(@"{0:f4} sec", sw.Elapsed.TotalSeconds);
        }
Beispiel #8
0
        public void TestProMexFilter()
        {
            var methodName = MethodBase.GetCurrentMethod().Name;

            TestUtils.ShowStarting(methodName);

            const string specFilePath = @"\\proto-2\UnitTest_Files\InformedProteomics_TestFiles\TopDown\ProductionQCShew\QC_Shew_Intact_26Sep14_Bane_C2Column3.raw";

            if (!File.Exists(specFilePath))
            {
                Assert.Ignore(@"Skipping test {0} since file not found: {1}", methodName, specFilePath);
            }

            var run = PbfLcMsRun.GetLcMsRun(specFilePath, 0, 0);

            const string ms1FtPath = @"\\proto-2\UnitTest_Files\InformedProteomics_TestFiles\TopDown\ProductionQCShew\QC_Shew_Intact_26Sep14_Bane_C2Column3.ms1ft";

            if (!File.Exists(ms1FtPath))
            {
                Assert.Ignore(@"Skipping test {0} since file not found: {1}", methodName, ms1FtPath);
            }

            var filter = new Ms1FtFilter(run, new Tolerance(10), ms1FtPath);

//            Console.WriteLine("ScanNums: {0}", string.Join("\t",filter.GetMatchingMs2ScanNums(8480.327609)));
            Assert.IsTrue(filter.GetMatchingMs2ScanNums(8480.327609).Contains(5255));
        }
Beispiel #9
0
        public void ScorePSM(int scan, string sequenceStr)
        {
            // Set input file paths.
            const string specFilePath =
                @"\\protoapps\userdata\Wilkins\UIMF Files\9 pep mix 365 mTorr with ims 45V CID\9 pep mix 365 mTorr with ims 45V CID.pbf";

            var lcmsRun = PbfLcMsRun.GetLcMsRun(specFilePath);

            var productSpectrum = lcmsRun.GetSpectrum(scan) as ProductSpectrum;

            Assert.NotNull(productSpectrum);

            var modification = Modification.RegisterAndGetModification("oh->nh2", new Composition(0, 1, 1, -1, 0));

            Assert.NotNull(modification);

            var searchModifications = new List <SearchModification>
            {
                new SearchModification(Modification.Get("oh->nh2"), 'M', SequenceLocation.ProteinCTerm, true),
                new SearchModification(Modification.Get("oh->nh2"), 'Q', SequenceLocation.ProteinCTerm, true),
                new SearchModification(Modification.PyroGluE, 'R', SequenceLocation.ProteinNTerm, true)
            };

            var aminoAcidSet = new AminoAcidSet(searchModifications, 1);
            var sequence     = this.LoadSequence(sequenceStr, aminoAcidSet);

            //var scorerFactory = new ScorerFactory(new Tolerance(30, ToleranceUnit.Ppm), 1, 5);
            //var scorer = scorerFactory.GetScorer(productSpectrum);

            //var score = IonUtils.ScoreSequence(scorer, sequence);

            //Console.WriteLine(score);
        }
        public void TestDisplaySpectra(string rawFile, string idFile)
        {
            // init
            var idFileReader = IdFileReaderFactory.CreateReader(idFile);
            var ids          = idFileReader.Read();
            var lcms         = PbfLcMsRun.GetLcMsRun(rawFile);
            var idList       = ids.ToList();

            foreach (var id in idList)
            {
                id.LcMs        = lcms;
                id.RawFileName = Path.GetFileNameWithoutExtension(rawFile);
            }
            idList.Sort(new PrSm.PrSmScoreComparer());

            var prsm = idList[0];

            // init XicPlotViewModel
            var dialogService     = new TestableMainDialogService();
            var spectrumViewModel = new SpectrumViewModel(dialogService, lcms);

            // init test ions
            var baseIonTypes = new List <BaseIonType> {
                BaseIonType.B, BaseIonType.Y
            };
            var neutralLosses = new List <NeutralLoss> {
                NeutralLoss.NoLoss
            };
            const int charge = 1;
            const int minCharge = 1, maxCharge = 2;
            var       ionTypeFactory = new IonTypeFactory(maxCharge);
            var       ionTypes       = IonUtils.GetIonTypes(ionTypeFactory, baseIonTypes, neutralLosses, minCharge, maxCharge);
            var       ions           = IonUtils.GetFragmentIonLabels(prsm.Sequence, charge, ionTypes);
            var       ionVms         = ions.Select(label => new LabeledIonViewModel(label.Composition, label.IonType, label.IsFragmentIon, lcms, label.PrecursorIon, label.IsChargeState, label.Index)).ToList();
        }
Beispiel #11
0
        public void TestDisplaySpectrum(string rawFile, string tsvFile)
        {
            // init
            var idFileReader = IdFileReaderFactory.CreateReader(tsvFile);
            var ids          = idFileReader.Read();
            var lcms         = PbfLcMsRun.GetLcMsRun(rawFile);
            var idList       = ids.ToList();

            foreach (var id in idList)
            {
                id.LcMs        = lcms;
                id.RawFileName = Path.GetFileNameWithoutExtension(rawFile);
            }

            // init SpectrumPlotViewModel
            var dialogService         = new TestableMainDialogService();
            var spectrumPlotViewModel = new SpectrumPlotViewModel(dialogService, new FragmentationSequenceViewModel(), 1.05, false);

            // init test data
            idList.Sort(new PrSm.PrSmScoreComparer());
            var prsm = idList[0];

            // init test ions
            var ions = new ReactiveList <LabeledIonViewModel>();

            spectrumPlotViewModel.Spectrum = prsm.Ms2Spectrum;
            ////spectrumPlotViewModel.Ions = ions;

            // plot should not be null
            Assert.NotNull(spectrumPlotViewModel.PlotModel);

            // plot should contain 1 stem series (the spectrum stem series)
            Assert.True(spectrumPlotViewModel.PlotModel.Series.Count == 1);
        }
Beispiel #12
0
        /// <summary>
        /// Returns InformedProteomics LcMsRun object from mass spec data types including .raw and .mzml
        /// </summary>
        /// <param name="rawFilePath"></param>
        /// <returns></returns>
        public LcMsRun GetLcMsData(string rawFilePath)
        {
            var progress = new Progress <ProgressData>();

            progress.ProgressChanged += Progress_ProgressChanged;

            var run = PbfLcMsRun.GetLcMsRun(rawFilePath, progress);

            /*
             * string ext = Path.GetExtension(rawFilePath);
             * switch (ext.ToLower())
             * {
             *  case ".raw":
             *      run = PbfLcMsRun.GetLcMsRun(rawFilePath, MassSpecDataType.XCaliburRun);
             *      break;
             *  case ".mzml":
             *      run = PbfLcMsRun.GetLcMsRun(rawFilePath, MassSpecDataType.MzMLFile);
             *      break;
             *  case ".gz":
             *      if (rawFilePath.ToLower().EndsWith(".mzml.gz"))
             *      {
             *          run = PbfLcMsRun.GetLcMsRun(rawFilePath, MassSpecDataType.MzMLFile);
             *      }
             *      break;
             * }*/

            return(run);
        }
Beispiel #13
0
        public void TestFeatureAlignment()
        {
            const string outFilePath = @"\\protoapps\UserData\Jungkap\CompRef\aligned\promex_crosstab_temp.tsv";

            var runLabels = new[] { "32A", "32B", "32C", "32D", "32E", "32F", "32G", "33A", "33B", "33C", "33D", "33E", "33F", "33G" };
            var nDataset  = runLabels.Length;

            var prsmReader = new ProteinSpectrumMatchReader();
            var tolerance  = new Tolerance(10);
            var alignment  = new LcMsFeatureAlignment(new CompRefFeatureComparer(tolerance));

            for (var i = 0; i < nDataset; i++)
            {
                var rawFile   = string.Format(@"{0}\CPTAC_Intact_CR{1}_24Aug15_Bane_15-02-06-RZ.pbf", RawFolder, runLabels[i]);
                var mspFile   = string.Format(@"{0}\CPTAC_Intact_CR{1}_24Aug15_Bane_15-02-06-RZ_IcTda.tsv", MsPfFolder, runLabels[i]);
                var ms1FtFile = string.Format(@"{0}\CPTAC_Intact_CR{1}_24Aug15_Bane_15-02-06-RZ.ms1ft", Ms1FtFolder, runLabels[i]);

                var run      = PbfLcMsRun.GetLcMsRun(rawFile);
                var features = LcMsFeatureAlignment.LoadProMexResult(i, ms1FtFile, run);

                if (File.Exists(mspFile))
                {
                    var prsmList = prsmReader.LoadIdentificationResult(mspFile, ProteinSpectrumMatch.SearchTool.MsPathFinder);

                    for (var j = 0; j < prsmList.Count; j++)
                    {
                        var match = prsmList[j];
                        match.ProteinId = match.ProteinName;
                    }

                    // tag features by PrSMs
                    for (var j = 0; j < features.Count; j++)
                    {
                        //features[j].ProteinSpectrumMatches = new ProteinSpectrumMatchSet(i);
                        var massTol = tolerance.GetToleranceAsMz(features[j].Mass);
                        foreach (var match in prsmList)
                        {
                            if (features[j].MinScanNum < match.ScanNum && match.ScanNum < features[j].MaxScanNum && Math.Abs(features[j].Mass - match.Mass) < massTol)
                            {
                                features[j].ProteinSpectrumMatches.Add(match);
                            }
                        }
                    }
                }

                alignment.AddDataSet(i, features, run);
            }

            alignment.AlignFeatures();

            Console.WriteLine("{0} alignments ", alignment.CountAlignedFeatures);

            for (var i = 0; i < nDataset; i++)
            {
                alignment.FillMissingFeatures(i);
                Console.WriteLine("{0} has been processed", runLabels[i]);
            }

            OutputCrossTabWithId(outFilePath, alignment, runLabels);
        }
        public void DoAnalysis()
        {
            InitilizeMatrix(_spectrumMatchesMatrix);
            InitilizeMatrix(_tagsGeneratedMatrix);
            InitilizeMatrix(_dataBaseHitMatrix);
            GetFilteredFeatures(_filteredFile);

            for (var i = 0; i < _rawFiles.Length; i++)
            {
                Console.WriteLine("Processing File {0}...............", i);
                var run     = PbfLcMsRun.GetLcMsRun(_rawFiles[i]);
                var ms2List = run.GetScanNumbers(2);
                Console.WriteLine("# of scans {0}", ms2List.Count);
                for (var j = 0; j < _filteredFeatures.Count; j++)
                {
                    var matchedSpecList = GetMatchedSpectrums(run, ms2List, _filteredFeatures[j], i);
                    _spectrumMatchesMatrix[j][i] = matchedSpecList.Count;

                    var tags = GetTags(matchedSpecList);
                    _tagsGeneratedMatrix[j][i] = tags.Count;

                    var hitCount = TagsInDatabase(tags);
                    _dataBaseHitMatrix[j][i] = hitCount;
                }
            }
        }
Beispiel #15
0
        private void AlignFeatures(List <string> datasets, string mspfFolder, string ms1ftFolder, string outFilePath)
        {
            var nDataset   = datasets.Count;
            var prsmReader = new ProteinSpectrumMatchReader();
            var tolerance  = new Tolerance(12);
            var alignment  = new LcMsFeatureAlignment(new AnalysisCompRef.CompRefFeatureComparer(tolerance));

            for (var i = 0; i < nDataset; i++)
            {
                var rawFile    = string.Format(@"{0}\{1}.pbf", PbfPath, datasets[i]);
                var mspFile    = string.Format(@"{0}\{1}_IcTda.tsv", mspfFolder, datasets[i]);
                var ms1FtFile  = string.Format(@"{0}\{1}.ms1ft", ms1ftFolder, datasets[i]);
                var ms1FtFile2 = string.Format(@"{0}\{1}.seqtag.ms1ft", ms1ftFolder, datasets[i]);

                var run       = PbfLcMsRun.GetLcMsRun(rawFile);
                var features  = LcMsFeatureAlignment.LoadProMexResult(i, ms1FtFile, run);
                var features2 = LcMsFeatureAlignment.LoadProMexResult(i, ms1FtFile2, run);
                features.AddRange(features2);

                if (File.Exists(mspFile))
                {
                    var prsmList = prsmReader.LoadIdentificationResult(mspFile, ProteinSpectrumMatch.SearchTool.MsPathFinder);
                    //var prsmFeatureMatch = new bool[prsmList.Count];

                    foreach (var match in prsmList)
                    {
                        match.ProteinId = match.ProteinName;
                    }

                    // tag features by PrSMs
                    foreach (var feature in features)
                    {
                        //features[j].ProteinSpectrumMatches = new ProteinSpectrumMatchSet(i);
                        var massTol = tolerance.GetToleranceAsMz(feature.Mass);
                        foreach (var match in prsmList)
                        {
                            if (feature.MinScanNum < match.ScanNum && match.ScanNum < feature.MaxScanNum && Math.Abs(feature.Mass - match.Mass) < massTol)
                            {
                                feature.ProteinSpectrumMatches.Add(match);
                                //prsmFeatureMatch[k] = true;
                            }
                        }
                    }
                }

                alignment.AddDataSet(i, features, run);
            }

            alignment.AlignFeatures();

            Console.WriteLine("{0} alignments ", alignment.CountAlignedFeatures);

            for (var i = 0; i < nDataset; i++)
            {
                alignment.FillMissingFeatures(i);
                Console.WriteLine("{0} has been processed", datasets[i]);
            }

            AnalysisCompRef.OutputCrossTabWithId(outFilePath, alignment, datasets);
        }
Beispiel #16
0
        public void TestMatchedPeakPostScorer()
        {
            var methodName = MethodBase.GetCurrentMethod().Name;

            Utils.ShowStarting(methodName);

            // Parameters
            var productIonTolerance = new Tolerance(10);
            var scorer = new MatchedPeakPostScorer(productIonTolerance, 1, 10);
            var sw     = new System.Diagnostics.Stopwatch();

            const int ms2ScanNum = 4658;
            var       sequence   = new Sequence("GYSIKDIIYQGEKSGVHNWQTLSGQNFYWHPDWLHIAEDLTGHKATASIQAEGTKATQNEAEQTIVKHLNKS", new AminoAcidSet());

            var specFilePath = Path.Combine(Utils.DEFAULT_SPEC_FILES_FOLDER, "QC_Shew_Intact_26Sep14_Bane_C2Column3.raw");

            if (!File.Exists(specFilePath))
            {
                Assert.Ignore(@"Skipping test {0} since file not found: {1}", methodName, specFilePath);
            }

            var run  = PbfLcMsRun.GetLcMsRun(specFilePath, 0, 0);
            var spec = run.GetSpectrum(ms2ScanNum) as ProductSpectrum;

            Assert.True(spec != null);

            sw.Start();
            var score = scorer.ComputeScore(spec, sequence);

            Console.WriteLine("{0}\t{1}\t{2}", sequence, ms2ScanNum, score);

            sw.Stop();

            Console.WriteLine(@"Elapsed Time: {0:f4} sec", sw.Elapsed.TotalSeconds);
        }
Beispiel #17
0
        public void TestDeconvolution()
        {
            var methodName = MethodBase.GetCurrentMethod().Name;

            Utils.ShowStarting(methodName);

            if (!File.Exists(TestRawFilePath))
            {
                Assert.Ignore(@"Skipping test " + methodName + @" since file not found: " + TestRawFilePath);
            }

            const int minScanNum = 46454;   // 635.43
            const int maxScanNum = 46661;   // 638.90
            const int MAX_POINTS = 50;

            var run = PbfLcMsRun.GetLcMsRun(TestRawFilePath) as PbfLcMsRun;

            if (run == null)
            {
                return;
            }
            var summedSpec = run.GetSummedMs1Spectrum(minScanNum, maxScanNum);

            summedSpec.FilterNoise(50.0);
            // summedSpec.Display(MAX_POINTS);

            var deconvoluted = ProductScorerBasedOnDeconvolutedSpectra.GetDeconvolutedSpectrum(summedSpec, 2, 45, new Tolerance(10), 0.9, 2);

            deconvoluted.Display(MAX_POINTS);
        }
Beispiel #18
0
        public void TestFeatureAlignment()
        {
            const string outFilePath = @"\\protoapps\UserData\Jungkap\Quant\aligned\promex_crosstab.tsv";
            //const string outFolder = @"\\protoapps\UserData\Jungkap\CompRef\aligned";
            var runLabels = new string[] { "1x1", "1x2", "1x3", "1x4", "1x5", "5x1", "5x2", "5x3", "5x4", "5x5", "10x1", "10x2", "10x3", "10x4", "10x5", };
            var nDataset  = runLabels.Length;

            var prsmReader = new ProteinSpectrumMatchReader();
            var tolerance  = new Tolerance(10);
            var alignment  = new LcMsFeatureAlignment(new SpikeInFeatureComparer(tolerance));

            for (var i = 0; i < nDataset; i++)
            {
                var rawFile   = string.Format(@"{0}\{1}.pbf", RawFolder, datasets[i]);
                var mspFile   = string.Format(@"{0}\{1}_IcTda.tsv", MsPfFolder, datasets[i]);
                var ms1FtFile = string.Format(@"{0}\{1}.ms1ft", Ms1FtFolder, datasets[i]);

                var run      = PbfLcMsRun.GetLcMsRun(rawFile);
                var prsmList = prsmReader.LoadIdentificationResult(mspFile, ProteinSpectrumMatch.SearchTool.MsPathFinder);
                var features = LcMsFeatureAlignment.LoadProMexResult(i, ms1FtFile, run);

                for (var j = 0; j < prsmList.Count; j++)
                {
                    var match = prsmList[j];
                    match.ProteinId = match.ProteinName;
                }

                // tag features by PrSMs
                for (var j = 0; j < features.Count; j++)
                {
                    //features[j].ProteinSpectrumMatches = new ProteinSpectrumMatchSet(i);
                    var massTol = tolerance.GetToleranceAsTh(features[j].Mass);
                    foreach (var match in prsmList)
                    {
                        if (features[j].MinScanNum < match.ScanNum && match.ScanNum < features[j].MaxScanNum && Math.Abs(features[j].Mass - match.Mass) < massTol)
                        {
                            features[j].ProteinSpectrumMatches.Add(match);
                        }
                    }
                }

                alignment.AddDataSet(i, features, run);
            }

            alignment.AlignFeatures();

            Console.WriteLine("{0} alignments ", alignment.CountAlignedFeatures);

            /*
             * for (var i = 0; i < nDataset; i++)
             * {
             *  alignment.FillMissingFeatures(i);
             *  Console.WriteLine("{0} has been processed", runLabels[i]);
             * }
             */
            OutputCrossTabWithId(outFilePath, alignment, runLabels);
        }
Beispiel #19
0
        private void FeatureMapGeneration()
        {
            var resultsFilePath = Path.Combine(Path.GetTempPath(), Path.GetFileNameWithoutExtension(mFeatureMapPbfFile) + "_FeatureMap.png");

            var map = new LcMsFeatureMap(PbfLcMsRun.GetLcMsRun(mFeatureMapPbfFile), mFeatureMapResultsFile, 2000, 50000);

            map.SaveImage(resultsFilePath);

            Console.WriteLine("Image saved to " + resultsFilePath);
        }
Beispiel #20
0
        public void TestFitMinusOneScore(int precursor, string adduct, string commonName, string id, string rawFilePath)
        {
            var lipid = new Lipid()
            {
                AdductFull = adduct, CommonName = commonName
            };
            var lipidTarget = lipid.CreateLipidTarget();

            var composition = lipidTarget.Composition;
            var compMinus1  = new Composition(composition.C, composition.H - 1, composition.N, composition.O, composition.S, composition.P); //Subtract one hydrogen to make this a minus1 fit score

            var lcmsRun = PbfLcMsRun.GetLcMsRun(rawFilePath);

            var spectrum = lcmsRun.GetSpectrum(precursor);

            var relativeIntensityThreshold = 0.1;

            var tolerance = new Tolerance(30, ToleranceUnit.Ppm);

            //Get the values to use to calculate pearson correlation
            var observedPeaks = LipidUtil.GetAllIsotopePeaks(spectrum, compMinus1, tolerance,
                                                             relativeIntensityThreshold);

            if (observedPeaks == null)
            {
                Console.WriteLine("Observed peaks is null for scan " + id);
            }

            var isotopomerEnvelope = IsoProfilePredictor.GetIsotopomerEnvelop(
                compMinus1.C,
                compMinus1.H,
                compMinus1.N,
                compMinus1.O,
                compMinus1.S);

            var observedIntensities = new double[observedPeaks.Length];

            for (var i = 0; i < observedPeaks.Length; i++)
            {
                var observedPeak = observedPeaks[i];
                observedIntensities[i] = observedPeak != null ? (float)observedPeak.Intensity : 0.0;
            }

            Console.WriteLine("The theoretical y values are: ");
            foreach (var value in isotopomerEnvelope.Envolope)
            {
                Console.WriteLine(value + ", ");
            }

            Console.WriteLine("The observed peak intensity x values are: ");
            foreach (var value in observedIntensities)
            {
                Console.WriteLine(value + ", ");
            }
        }
Beispiel #21
0
        public void TestSumIsoProfilesAcrossDifferentCharges()
        {
            var methodName = MethodBase.GetCurrentMethod().Name;

            Utils.ShowStarting(methodName);

            if (!File.Exists(TestRawFilePath))
            {
                Assert.Ignore(@"Skipping test " + methodName + @" since file not found: " + TestRawFilePath);
            }

            var run = PbfLcMsRun.GetLcMsRun(TestRawFilePath) as PbfLcMsRun;

            //var spec = run.GetSpectrum(46452); // 635.37
            var spec      = run.GetSummedMs1Spectrum(46437, 46466);
            var tolerance = new Tolerance(10);

            const string protSequence =
                "AIPQSVEGQSIPSLAPMLERTTPAVVSVAVSGTHVSKQRVPDVFRYFFGPNAPQEQVQERPFRGLGSGVIIDADKGYIVTNNHVIDGADDIQVGLHDGREVKAKLIGTDSESDIALLQIEAKNLVAIKTSDSDELRVGDFAVAIGNPFGLGQTVTSGIVSALGRSGLGIEMLENFIQTDAAINSGNSGGALVNLKGELIGINTAIVAPNGGNVGIGFAIPANMVKNLIAQIAEHGEVRRGVLGIAGRDLDSQLAQGFGLDTQHGGFVNEVSAGSAAEKAGIKAGDIIVSVDGRAIKSFQELRAKVATMGAGAKVELGLIRDGDKKTVNVTLGEANQTTEKAAGAVHPMLQGASLENASKGVEITDVAQGSPAAMSGLQKGDLIVGINRTAVKDLKSLKELLKDQEGAVALKIVRGKSMLYLVLR";
            //const string annotation = "_." + protSequence + "._";
            var seqGraph = SequenceGraph.CreateGraph(new AminoAcidSet(), AminoAcid.ProteinNTerm, protSequence, AminoAcid.ProteinCTerm);

            if (seqGraph == null)
            {
                return;
            }
            seqGraph.SetSink(0);
            var neutral = seqGraph.GetSinkSequenceCompositionWithH2O();

            var theoProfile = neutral.GetIsotopomerEnvelopeRelativeIntensities();
            var expProfile  = new double[theoProfile.Length];

            for (var charge = 22; charge <= 45; charge++)
            {
                var ion          = new Ion(neutral, charge);
                var isotopePeaks = spec.GetAllIsotopePeaks(ion, tolerance, 0.1);
                if (isotopePeaks == null)
                {
                    continue;
                }
                Assert.True(isotopePeaks.Length == theoProfile.Length);
                for (var i = 0; i < isotopePeaks.Length; i++)
                {
                    if (isotopePeaks[i] != null)
                    {
                        expProfile[i] += isotopePeaks[i].Intensity;
                    }
                }
            }
            for (var i = 0; i < theoProfile.Length; i++)
            {
                Console.WriteLine("{0}\t{1}\t{2}", neutral.GetIsotopeMass(i), theoProfile[i], expProfile[i] / expProfile.Max());
            }
            Console.WriteLine("Corr: " + FitScoreCalculator.GetPearsonCorrelation(theoProfile, expProfile));
        }
Beispiel #22
0
 public void CountTagMatches()
 {
     for (var i = 1; i < 52; i++)
     {
         var dataName = "Lewy_intact_" + i.ToString("D2");
         var filePath = string.Format(@"{0}\{1}.pbf", PbfPath, dataName);
         var run      = PbfLcMsRun.GetLcMsRun(filePath);
         var scans    = run.GetScanNumbers(2);
         Console.WriteLine(scans.Count);
     }
 }
Beispiel #23
0
        /// <summary>
        /// Implementation for <see cref="RunCommand"/>.
        /// Gets a command that validates search settings and closes the window.
        /// </summary>
        /// <returns>The <see cref="Task"/>.</returns>
        private async Task RunImplementation()
        {
            this.SearchRunning = true;

            this.runSearchCancellationToken = new CancellationTokenSource();

            // Read spectrum file
            var lcms = await Task.Run(() => PbfLcMsRun.GetLcMsRun(this.SpectrumFilePath, 0, 0), this.runSearchCancellationToken.Token);

            // Get MS/MS scan numbers
            IEnumerable <int> ms2Scans = null;

            if (this.MaxScanNumber > 0 && (this.MaxScanNumber - this.MinScanNumber) >= 0)
            {
                var allMs2Scans = lcms.GetScanNumbers(2);
                ms2Scans = allMs2Scans.Where(scan => scan >= this.MinScanNumber && scan <= this.MaxScanNumber);
            }

            // Create truncated FASTA
            this.truncatedFastaDbFilePath = this.CreateTruncatedFastaFile();

            // Progress updater
            this.SearchProgressPercent = 0.0;
            this.SearchProgressStatus  = "Searching...";
            var progress = new Progress <ProgressData>(progressData =>
            {
                this.SearchProgressPercent = progressData.Percent;
                this.SearchProgressStatus  = progressData.Status;
            });

            // Run Search
            var topDownLauncher = this.GetTopDownLauncher(ms2Scans);

            this.runSearchTask = Task.Run(
                () => topDownLauncher.RunSearch(
                    IcParameters.Instance.IonCorrelationThreshold,
                    this.runSearchCancellationToken.Token,
                    progress),
                this.runSearchCancellationToken.Token);
            await this.runSearchTask;
            ////topDownLauncher.RunSearch(IcParameters.Instance.IonCorrelationThreshold);
            this.SearchRunning = false;

            this.runSearchCancellationToken = null;

            // Results delivered on close
            this.Status = true;
            if (this.ReadyToClose != null)
            {
                this.ReadyToClose(this, EventArgs.Empty);
            }
        }
Beispiel #24
0
        public void TestTagBasedSearchCompRef()
        {
            var methodName = MethodBase.GetCurrentMethod().Name;

            TestUtils.ShowStarting(methodName);

            const string dataSetPath   = @"D:\MassSpecFiles\CompRef";
            const string fastaFilePath = @"D:\MassSpecFiles\CompRef\ID_003278_4B4B3CB1.fasta";
            const string modsFilePath  = @"D:\MassSpecFiles\CompRef\Mods.txt";

            if (!Directory.Exists(dataSetPath))
            {
                Assert.Ignore(@"Skipping test {0} since folder not found: {1}", methodName, dataSetPath);
            }
            if (!File.Exists(modsFilePath))
            {
                Assert.Ignore(@"Skipping test {0} since file not found: {1}", methodName, modsFilePath);
            }
            if (!File.Exists(fastaFilePath))
            {
                Assert.Ignore(@"Skipping test {0} since file not found: {1}", methodName, fastaFilePath);
            }

            var fileEntries = Directory.GetFiles(dataSetPath);

            var dataset = (from fileName in fileEntries where fileName.EndsWith("pbf") select Path.GetFileNameWithoutExtension(fileName)).ToList();

            dataset.Sort();


            var fastaDb   = new FastaDatabase(fastaFilePath);
            var tolerance = new Tolerance(10);
            var aaSet     = new AminoAcidSet(modsFilePath);

            for (var i = 0; i < dataset.Count; i++)
            {
                var rawFile     = string.Format(@"{0}\{1}.pbf", dataSetPath, dataset[i]);
                var ms1File     = string.Format(@"{0}\{1}.ms1ft", dataSetPath, dataset[i]);
                var tagFilePath = MassSpecDataReaderFactory.ChangeExtension(rawFile, ".seqtag");

                var       run          = PbfLcMsRun.GetLcMsRun(rawFile);
                const int minTagLength = 5;
                //var tagParser = new SequenceTagParser(tagFilePath, minTagLength, 100);

                Console.WriteLine("-----------------{0}--------------------", rawFile);

                TestTagBasedSearch(run, fastaDb, tolerance, aaSet);

                Console.WriteLine("-----------------------------------------------------------------------");
            }
        }
Beispiel #25
0
        public void TestTagBasedSearch()
        {
            var methodName = MethodBase.GetCurrentMethod().Name;

            Utils.ShowStarting(methodName);

//            const string rawFilePath = @"H:\Research\Lewy\raw\Lewy_intact_01.raw";
//            const string rawFilePath = @"H:\Research\QCShew_TopDown\Production\QC_Shew_Intact_26Sep14_Bane_C2Column3.raw";
//            const string rawFilePath = @"H:\Research\Yufeng\TopDownYufeng\raw\yufeng_column_test2.raw";
//            const string rawFilePath = @"H:\Research\Weijun_TopDown\raw\UC4_Intact_plasmaTest_90_6May15_Bane_14-09-01RZ.raw";
//            const string rawFilePath = @"H:\Research\Charles\TopDown\raw\SBEP_STM_001_02272012_Aragon.raw";
            const string rawFilePath = @"D:\MassSpecFiles\60k\Yufeng_SampleTest1_150614113438.pbf";

            //const string rawFilePath = @"D:\MassSpecFiles\60k\NCR_50K_Test_24Jun15_Bane_15-02-02RZ.pbf";

            if (!File.Exists(rawFilePath))
            {
                Assert.Ignore(@"Skipping test {0} since file not found: {1}", methodName, rawFilePath);
            }

            var run = PbfLcMsRun.GetLcMsRun(rawFilePath);

            //const int minTagLength = 5;
            var tagFilePath = MassSpecDataReaderFactory.ChangeExtension(rawFilePath, ".seqtag");
            //var tagParser = new SequenceTagParser(tagFilePath, minTagLength, 100);

            const string fastaFilePath = @"D:\MassSpecFiles\60k\ID_003836_DA9CC1E4.fasta";

            //const string fastaFilePath = @"D:\MassSpecFiles\60k\ID_004973_9BA6912F.fasta";
            if (!File.Exists(fastaFilePath))
            {
                Assert.Ignore(@"Skipping test {0} since file not found: {1}", methodName, fastaFilePath);
            }

            var fastaDb = new FastaDatabase(fastaFilePath);

            var tolerance = new Tolerance(10);
//            var modsFilePath = @"H:\Research\QCShew_TopDown\Production\Mods_Methyl.txt";
            var modsFilePath = @"D:\MassSpecFiles\60k\Mods.txt";

//            var modsFilePath = "";

            if (!File.Exists(modsFilePath))
            {
                Assert.Ignore(@"Skipping test {0} since file not found: {1}", methodName, modsFilePath);
            }

            var aaSet = new AminoAcidSet(modsFilePath);

            TestTagBasedSearch(run, fastaDb, tolerance, aaSet);
        }
Beispiel #26
0
        public void TestIanCidData()
        {
            const string specFilePath =
                @"\\protoapps\userdata\Wilkins\UIMF Files\9 pep mix 365 mTorr with ims 45V CID\9 pep mix 365 mTorr with ims 45V CID.UIMF";
            const string fastaFilePath   = @"\\protoapps\userdata\Wilkins\UIMF Files\melittin.fasta";
            const string outputDirectory =
                @"\\protoapps\userdata\Wilkins\UIMF Files\9 pep mix 365 mTorr with ims 45V CID";

            const double correlationThreshold = 0.7;

            // Add missing modifications

            // Initialize search modifications
            var searchModifications = new List <SearchModification> {
            };
            var aminoAcidSet        = new AminoAcidSet(searchModifications, 1);

            // Initialize spectrum file
            var lcmsRun     = PbfLcMsRun.GetLcMsRun(specFilePath);
            var scanNumbers = lcmsRun.GetScanNumbers(2);

            // Initialize MSPathFinder
            //var launcher = new IcTopDownLauncher(
            //    specFilePath,
            //    fastaFilePath,
            //    outputDirectory,
            //    aminoAcidSet)
            //{
            //    MinSequenceLength = 1,
            //    MaxSequenceLength = 100,
            //    MaxNumNTermCleavages = 1,
            //    MaxNumCTermCleavages = 0,
            //    MinPrecursorIonCharge = 1,
            //    MaxPrecursorIonCharge = 20,
            //    MinProductIonCharge = 1,
            //    MaxProductIonCharge = 20,
            //    MinSequenceMass = 1,
            //    MaxSequenceMass = 30000,
            //    PrecursorIonTolerancePpm = 100,
            //    ProductIonTolerancePpm = 100,
            //    RunTargetDecoyAnalysis = DatabaseSearchMode.Both,
            //    SearchMode = InternalCleavageType.NoInternalCleavage,
            //    MaxNumThreads = 4,
            //    ScanNumbers = scanNumbers,
            //    NumMatchesPerSpectrum = 1,
            //    TagBasedSearch = false,
            //};

            //launcher.RunSearch(correlationThreshold);
        }
Beispiel #27
0
        public void TestFeatureMapGeneration()
        {
            Console.WriteLine("Testing Working");
            var methodName = MethodBase.GetCurrentMethod().Name;

            TestUtils.ShowStarting(methodName);
            const string rawFile    = @"\\protoapps\UserData\Jungkap\Joshua\testData\QC_Shew_Intact_26Sep14_Bane_C2Column3.pbf";
            const string testFile   = @"\\protoapps\UserData\Jungkap\Joshua\FeatureMap\QC_Shew_Intact_26Sep14_Bane_C2Column3.ms1ft";
            const string outputFile = @"D:\MassSpecFiles\training\raw\";

            var map = new LcMsFeatureMap(PbfLcMsRun.GetLcMsRun(rawFile), testFile, 2000, 50000);

            map.SaveImage(outputFile + "test.png");
        }
Beispiel #28
0
        public void TestReadingProMexFile(double massToFind, string expectedScanNumbers)
        {
            var methodName = MethodBase.GetCurrentMethod().Name;

            Utils.ShowStarting(methodName);

            var pbfFilePath = Utils.GetPbfTestFilePath(false);
            var pbfFile     = Utils.GetTestFile(methodName, pbfFilePath);

            var promexFilePath = Path.Combine(Utils.DEFAULT_SPEC_FILES_FOLDER, "QC_Shew_Intact_26Sep14_Bane_C2Column3_Excerpt.ms1ft");
            var promexFile     = Utils.GetTestFile(methodName, promexFilePath);

            var run = PbfLcMsRun.GetLcMsRun(pbfFile.FullName);

            Console.Write("Reading ProMex results...");
            var ms1Filter = new Ms1FtFilter(run, new Tolerance(10), promexFile.FullName);

            Console.WriteLine();

            var matchingScanNums = new SortedSet <int>();

            foreach (var item in ms1Filter.GetMatchingMs2ScanNums(massToFind))
            {
                matchingScanNums.Add(item);
            }

            var scanNumList = string.Join(",", matchingScanNums);

            Console.WriteLine("Scans with mass {0}:", massToFind);
            Console.WriteLine(scanNumList);

            var expectedScanNumList = expectedScanNumbers.Split(',');

            var matchCount = 0;

            foreach (var scanNumText in expectedScanNumList)
            {
                var scanNum = int.Parse(scanNumText);

                if (!matchingScanNums.Contains(scanNum))
                {
                    Assert.Fail("Did not find scan {0} for mass {1}", scanNum, massToFind);
                }

                matchCount++;
            }

            Assert.AreEqual(matchCount, matchingScanNums.Count, "Found extra matching scan nums vs. what was expected");
        }
Beispiel #29
0
        public void TestCptacSpikeIn()
        {
            const string featureFolder = @"D:\MassSpecFiles\CPTAC_spike_in\promex";
            const string rawFolder     = @"D:\MassSpecFiles\CPTAC_spike_in\raw";
            var          outFilePath   = string.Format(@"{0}\aligned_features.tsv", featureFolder);
            var          align         = new LcMsFeatureAlignment(new LcMsFeatureAlignComparer(new Tolerance(10)));

            for (var i = 0; i < spikeDatasets.Length; i++)
            {
                var featureFilePath = string.Format(@"{0}\{1}.ms1ft", featureFolder, spikeDatasets[i]);
                var rawFile         = string.Format(@"{0}\{1}.pbf", rawFolder, spikeDatasets[i]);

                if (!File.Exists(rawFile))
                {
                    Console.WriteLine(@"Warning: Skipping file not found: {0}", rawFile);
                    continue;
                }


                if (!File.Exists(featureFilePath))
                {
                    Console.WriteLine(@"Warning: Skipping file not found: {0}", featureFilePath);
                    continue;
                }
                var run = PbfLcMsRun.GetLcMsRun(rawFile);
                var s   = 0d;
                foreach (var scanNum in run.GetMs1ScanVector())
                {
                    var spec            = run.GetSpectrum(scanNum);
                    var summedIntensity = spec.Peaks.Sum(p => p.Intensity);
                    s += summedIntensity;
                }
                foreach (var scanNum in run.GetScanNumbers(2))
                {
                    var spec            = run.GetSpectrum(scanNum);
                    var summedIntensity = spec.Peaks.Sum(p => p.Intensity);
                    s += summedIntensity;
                }

                Console.WriteLine("{0}\t{1}", i, s);
                //var features = LcMsFeatureAlignment.LoadProMexResult(i, featureFilePath, run);

                //align.AddDataSet(i, features, run);
            }
            //align.AlignFeatures();
            //Console.WriteLine("# of aligned features = {0}", align.CountAlignedFeatures);
            //align.RefineAbundance();
            //OutputAlignmentResult(align, outFilePath, spikeDatasets);
        }
Beispiel #30
0
        public void TestFeatureExampleForFigure()
        {
            var methodName = MethodBase.GetCurrentMethod().Name;

            Utils.ShowStarting(methodName);

            const string rawFile = @"\\proto-11\MSXML_Cache\PBF_Gen_1_193\2015_1\CPTAC_Intact_rep6_15Jan15_Bane_C2-14-08-02RZ.pbf";

            //const string rawFile = @"D:\MassSpecFiles\training\raw\QC_Shew_Intact_26Sep14_Bane_C2Column3.pbf";

            if (!File.Exists(rawFile))
            {
                Assert.Ignore(@"Skipping test {0} since file not found: {1}", methodName, rawFile);
            }

            var run           = PbfLcMsRun.GetLcMsRun(rawFile);
            var scorer        = new LcMsFeatureLikelihood();
            var featureFinder = new LcMsPeakMatrix(run, scorer);
            var feature       = featureFinder.GetLcMsPeakCluster(28061.6177, 20, 34, 7624, 7736);

            var resultsFilePath = Path.Combine(Path.GetTempPath(), Path.GetFileNameWithoutExtension(rawFile) + "_peaks.txt");
            var writer          = new StreamWriter(resultsFilePath);

            writer.Write("{0}\t{1}\t{2}\t{3}\t{4}\t{5}\t{6}\n", "Scan", "Elution_Time", "Charge", "ID", "MZ", "Intensity", "Pearson_Correlation");

            var envelope = feature.TheoreticalEnvelope;

            foreach (var e in envelope.Isotopes)
            {
                Console.WriteLine(e.Ratio);
            }

            foreach (var env in feature.EnumerateEnvelopes())
            {
                var corr = env.PearsonCorrelation;
                for (var i = 0; i < envelope.Size; i++)
                {
                    var peak = env.Peaks[i];
                    if (peak == null)
                    {
                        continue;
                    }
                    writer.Write("{0}\t{1}\t{2}\t{3}\t{4}\t{5}\t{6}\n", env.ScanNum, run.GetElutionTime(env.ScanNum), env.Charge, i, peak.Mz, peak.Intensity, corr);
                }
            }
            writer.Close();

            Console.WriteLine("Results are in file " + resultsFilePath);
        }